![Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Analysis in human tonsil and cerebral cortex tissues. Corresponding Granzyme K RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Granzyme-K-Antibody-Immunohistochemistry-Paraffin-NBP2-49387-img0007.jpg "Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Analysis in human tonsil and cerebral cortex tissues. Corresponding Granzyme K RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GZMK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Immunocytochemistry_10939.jpg)
![ELISA Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_ELISA_22249.jpg)
![Western Blot Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Western_Blot_23415.jpg)
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
| Publications using NBP2-49387 | Applications | Species |
|---|---|---|
| Christopher T, Matthew Z, Wendy B et al. Granzyme K contributes to endothelial microvascular damage and leakage during skin inflammation Br J Dermatol. 2022-10-23 [PMID: 36652225] (Immunohistochemistry-Paraffin, Human) | Immunohistochemistry-Paraffin | Human |
| Christopher T, Matthew Z, Katlyn R et al. Granzyme K Expressed by Classically Activated Macrophages Contributes to Inflammation and Impaired Remodeling J Invest Dermatol. 2018-11-03 [PMID: 30395844] (Immunohistochemistry-Paraffin, Human) | Immunohistochemistry-Paraffin | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC | Human | 06/16/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Granzyme K Antibody (NBP2-49387)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GZMK |
![Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human spleen shows strong granular cytoplasmic positivity in cells in red pulp.](http://images.novusbio.com/fullsize/Granzyme-K-Antibody-Immunohistochemistry-Paraffin-NBP2-49387-img0011.jpg "Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human spleen shows strong granular cytoplasmic positivity in cells in red pulp.")
![Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/Granzyme-K-Antibody-Immunohistochemistry-Paraffin-NBP2-49387-img0004.jpg "Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human tonsil shows high expression.")
![Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Granzyme-K-Antibody-Immunohistochemistry-Paraffin-NBP2-49387-img0008.jpg "Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human rectum shows weak granular cytoplasmic positivity in leukocytes.](http://images.novusbio.com/fullsize/Granzyme-K-Antibody-Immunohistochemistry-Paraffin-NBP2-49387-img0009.jpg "Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human rectum shows weak granular cytoplasmic positivity in leukocytes.")
![Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Granzyme-K-Antibody-Immunohistochemistry-Paraffin-NBP2-49387-img0010.jpg "Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
