Home » Granzyme A » Granzyme A Proteins » Granzyme A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Granzyme A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Granzyme A Protein (NBP2-38717PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Granzyme A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GZMA.

Source: E. coli

Amino Acid Sequence: GRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GZMA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38717.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Granzyme A Recombinant Protein Antigen

  • CTL Tryptase
  • CTLA3
  • CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease)
  • Cytotoxic T-lymphocyte proteinase 1
  • EC 3.4.21
  • Fragmentin-1
  • granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
  • Granzyme A
  • Granzyme-1
  • GZMA
  • H factor
  • Hanukkah factor
  • HF
  • HFSP
  • HFSPEC 3.4.21.78

Background

The biological function of Granzyme A is unclear. It would appear that the molecule may have a role in the induction of apoptosis via its activity as a serine protease, but this would seem to be subsidiary to the role of Granzyme B. Granzyme A deficient mice are indistinguishable from normal animals in their response to infection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lactoferrin
Antibody (1C6cc)
NB120-10109
CyTOF-ready Lactoferrin Antibody (1C6cc)
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
NT-proBNP Antibody
(OTI11G4)
NBP2-46201
Western Blot NT-proBNP Antibody (OTI11G4)
Immunohistochemistry NT-proBNP Antibody (OTI11G4)
Immunohistochemistry NT-proBNP Antibody (OTI11G4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(656 Publications)
Species: Mu
Applications: ELISA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
PD-ECGF/Thymidine
Phosphorylase Antibod ...
NB100-2737
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Huntingtin Antibody
NBP3-13106
Western Blot Huntingtin Antibody
Immunohistochemistry-Paraffin Huntingtin Antibody
Immunocytochemistry/ Immunofluorescence Huntingtin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Lipocalin-1
Antibody (10B10) - BS
NBP1-28872
Western Blot Lipocalin-1 Antibody (10B10) - BSA Free
Immunocytochemistry/ Immunofluorescence Lipocalin-1 Antibody (10B10) - BSA Free
Immunohistochemistry-Paraffin Lipocalin-1 Antibody (10B10) - BSA Free
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Thymopoietin/LAP2
Antibody
NBP1-87822
Immunocytochemistry/ Immunofluorescence Thymopoietin/LAP2 Antibody
Western Blot Thymopoietin/LAP2 Antibody
Western Blot Thymopoietin/LAP2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for Granzyme A Protein (NBP2-38717PEP) (0)

There are no publications for Granzyme A Protein (NBP2-38717PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme A Protein (NBP2-38717PEP) (0)

There are no reviews for Granzyme A Protein (NBP2-38717PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Granzyme A Protein (NBP2-38717PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Granzyme A Products

Research Areas for Granzyme A Protein (NBP2-38717PEP)

Find related products by research area.

Blogs on Granzyme A

There are no specific blogs for Granzyme A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Granzyme A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GZMA