![Western Blot: GPR175 Antibody (6D7) [H00131601-M01] - Analysis of GPR175 over-expressed 293 cell line, cotransfected with GPR175 Validated Chimera RNAi ( Cat # H00131601-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GPR175 monoclonal antibody (M01), clone 6D7 (Cat # H00131601-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/GPR175-Antibody-6D7-Western-Blot-H00131601-M01-img0003.jpg "Western Blot: GPR175 Antibody (6D7) [H00131601-M01] - Analysis of GPR175 over-expressed 293 cell line, cotransfected with GPR175 Validated Chimera RNAi ( Cat # H00131601-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GPR175 monoclonal antibody (M01), clone 6D7 (Cat # H00131601-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, KD |
| Clone | 6D7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | GPR175 (NP_057456, 281 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI |
| Localization | Cell Membrane |
| Specificity | GPR175 - G protein-coupled receptor 175 |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TPRA1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA and RNAi Validation. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GPR175 Antibody (H00131601-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: GPR175 Antibody (6D7) [H00131601-M01] - Analysis of GPR175 expression in transfected 293T cell line by GPR175 monoclonal antibody (M01), clone 6D7.Lane 1: GPR175 transfected lysate(41.053 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/GPR175-Antibody-6D7-Western-Blot-H00131601-M01-img0004.jpg "Western Blot: GPR175 Antibody (6D7) [H00131601-M01] - Analysis of GPR175 expression in transfected 293T cell line by GPR175 monoclonal antibody (M01), clone 6D7.Lane 1: GPR175 transfected lysate(41.053 KDa).Lane 2: Non-transfected lysate.")
![N/A CCL20/MIP-3 alpha [HRP]](https://images.novusbio.com/images2/DATA_CCL20_DM3A00_ELISA_752.jpg)
![N/A CCL20/MIP-3 alpha [HRP]](https://images.novusbio.com/images2/DATA_CCL20_DM3A00_ELISA_753.jpg)
![N/A CCL20/MIP-3 alpha [HRP]](https://images.novusbio.com/images2/CCL20_DM3A00_ELISA_137.jpg)
