![Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of GSTP1 expression in transfected 293T cell line by GSTP1 monoclonal antibody (M01), clone 2G6-F6.Lane 1: GSTP1 transfected lysate (Predicted MW: 23.3 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-2G6-F6-Western-Blot-H00002950-M01-img0006.jpg "Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of GSTP1 expression in transfected 293T cell line by GSTP1 monoclonal antibody (M01), clone 2G6-F6.Lane 1: GSTP1 transfected lysate (Predicted MW: 23.3 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP, ELISA |
| Clone | 2G6-F6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | GSTP1 (AAH10915, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Specificity | GSTP1 - glutathione S-transferase pi |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GSTP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publications using H00002950-M01 | Applications | Species |
|---|---|---|
| Khabaz MN. Polymorphism of the glutathione S-transferase P1 gene (GST-pi) in breast carcinoma. Pol J Pathol. 2014-06-01 [PMID: 25119175] | ||
| Kan CY, Wen VW, Pasquier E et al. Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization. Oncogene. 2012-02-06 [PMID: 22310292] | ||
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of monoclonal antibody to GSTP1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-2G6-F6-Immunocytochemistry-Immunofluorescence-H00002950-M01-img0004.jpg "Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of monoclonal antibody to GSTP1 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunoprecipitation: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of GSTP1 transfected lysate using anti-GSTP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTP1 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-2G6-F6-Immunoprecipitation-H00002950-M01-img0005.jpg "Immunoprecipitation: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Analysis of GSTP1 transfected lysate using anti-GSTP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTP1 MaxPab rabbit polyclonal antibody.")
![Sandwich ELISA Capture: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Detection limit for recombinant GST tagged Glutathione S-Transferase pi 1/GSTP1 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-2G6-F6-Sandwich-ELISA-Capture-H00002950-M01-img0007.jpg "Sandwich ELISA Capture: Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [H00002950-M01] - Detection limit for recombinant GST tagged Glutathione S-Transferase pi 1/GSTP1 is 0.03 ng/ml as a capture antibody.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")