Novus Biologicals products are now on bio-techne.com

Glutaminase Recombinant Protein Antigen

Name: Glutaminase Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89766PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Glutaminase Protein (NBP1-89766PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Glutaminase Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLS. Source: E. coli Amino Acid Sequence: DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	GLS
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89766. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glutaminase Recombinant Protein Antigen

AAD20
EC 3.5.1.2
GLS
GLS1DKFZp686O15119
glutaminase C
glutaminase kidney isoform, mitochondrial
Glutaminase
glutaminase, phosphate-activated
K-Glutaminase
KIAA0838FLJ10358
L-Glutamine Amidohydrolase

Background

Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glutamine
Synthetase Antibody

NB110-41404

Western Blot Glutamine Synthetase Antibody

Immunohistochemistry Glutamine Synthetase Antibody

(1 Review)

(11 Publications)

Species: Bv, Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

GLS2 Antibody -
BSA Free

NBP1-76544

Immunohistochemistry GLS2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence GLS2 Antibody - BSA Free

(7 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB

GLYAT Antibody

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody

Species: Hu

Applications: IHC, IHC-P, WB

PAG1 Antibody
(504004) [Unconjugate

MAB5285

Western Blot PAG1 Antibody (504004) [Unconjugated]

(1 Publication)

Species: Hu

Applications: Simple Western, WB

Peroxiredoxin 1
Antibody

NBP1-82558

(8 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

AGA Antibody

NBP1-88866

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

ASRGL1 Antibody

NBP1-89133

Immunohistochemistry-Paraffin ASRGL1 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

GGT1 Antibody (1F9)

H00002678-M01

Immunohistochemistry-Paraffin GGT1 Antibody (1F9)

(10 Publications)

Species: Hu, Mu, Ye

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

APC Antibody - BSA
Free

NB100-91662

Immunohistochemistry-Paraffin APC Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

GMPS Antibody
(1D10)

H00008833-M01

(1 Publication)

Species: Hu

Applications: ELISA, Flow, IHC, IHC-P, S-ELISA, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(818 Publications)

Species: Hu

Applications: BA

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Glucose
1-dehydrogenase Antib ...

NBP2-02615

Flow Cytometry Glucose 1-dehydrogenase Antibody (OTI2A7)

Species: Hu, Pm, Pm

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CS Citrate
Synthase Antibody (17

NBP2-43648

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt, Ze

Applications: ICC/IF, IHC, IHC-P, WB

Glutamate
Dehydrogenase Antibod

NBP2-16679

Immunocytochemistry/ Immunofluorescence Glutamate Dehydrogenase Antibody

Immunohistochemistry-Paraffin Glutamate Dehydrogenase Antibody

(4 Publications)

Species: Dr, Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

UDP glucose
dehydrogenase Antibod

NBP1-90906

Immunohistochemistry-Paraffin UDP glucose dehydrogenase Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TAX1BP3 Antibody
(4A10)

H00030851-M01

(1 Review)

(1 Publication)

Species: Hu

Applications: ELISA, S-ELISA, Simple Western, WB

PD-ECGF/Thymidine
Phosphorylase Antibod ...

NB100-2737

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IP, WB

Glutaminase
Recombinant Protein A

NBP1-89766PEP

Species: Hu

Applications: AC

Publications for Glutaminase Protein (NBP1-89766PEP) (0)

There are no publications for Glutaminase Protein (NBP1-89766PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutaminase Protein (NBP1-89766PEP) (0)

There are no reviews for Glutaminase Protein (NBP1-89766PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glutaminase Protein (NBP1-89766PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutaminase Products

Research Areas for Glutaminase Protein (NBP1-89766PEP)

Find related products by research area.

Blogs on Glutaminase

There are no specific blogs for Glutaminase, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Glutaminase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

GLS

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Glutaminase Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Glutaminase Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Glutaminase Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Glutaminase Protein (NBP1-89766PEP) (0)

Reviews for Glutaminase Protein (NBP1-89766PEP) (0)

FAQs for Glutaminase Protein (NBP1-89766PEP) (0)

Additional Glutaminase Products

Research Areas for Glutaminase Protein (NBP1-89766PEP)

Blogs on Glutaminase

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics