GFI1B Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse GFI1B. Peptide sequence: QVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQHN The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GFI1B |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for GFI1B Antibody
Background
The GFI1B gene codes for a zinc finger protein Gfi-1b. Isoform 1 (p37) is 330 amino acids in length at around 37 kDA while isoform 2 (p32) is 284 amino acids long at approximately 32 kDA. GFI1B is essential in transcriptional regulation which is critical for the development and differentiation of erythroid and magakaryocytic lineages. Research is investigating the role of GFI1B in aplastic anemia, ataxia, chronic leukemia, anemia, neutropenia, and hematopoiesis. This gene has interacted with JAG2, BRE, LTBP4, EFEMP1, and EFEMP2 to contribute to pathways of lymphocyte signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: WB
Publications for GFI1B Antibody (NBP2-84041) (0)
There are no publications for GFI1B Antibody (NBP2-84041).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GFI1B Antibody (NBP2-84041) (0)
There are no reviews for GFI1B Antibody (NBP2-84041).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GFI1B Antibody (NBP2-84041) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GFI1B Products
Research Areas for GFI1B Antibody (NBP2-84041)
Find related products by research area.
|
Blogs on GFI1B