![Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining in human placenta and skeletal muscle tissues using NBP2-52917 antibody. Corresponding GDF15 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Immunohistochemistry-Paraffin-NBP2-52917-img0013.jpg "Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining in human placenta and skeletal muscle tissues using NBP2-52917 antibody. Corresponding GDF15 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL0328 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL |
| Epitope | NQSWEDSNTD |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GDF15 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GDF-15 Antibody (NBP2-52917)Find related products by research area.
|
|
Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GDF15 |
![Western Blot: GDF-15 Antibody (CL0328) [NBP2-52917] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GDF15 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Western-Blot-NBP2-52917-img0005.jpg "Western Blot: GDF-15 Antibody (CL0328) [NBP2-52917] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GDF15 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Immunocytochemistry/Immunofluorescence: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of A549 cells using the Anti-GDF15 monoclonal antibody, showing specific staining in the nucleus in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Immunocytochemistry-Immunofluorescence-NBP2-52917-img0008.jpg "Immunocytochemistry/Immunofluorescence: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of A549 cells using the Anti-GDF15 monoclonal antibody, showing specific staining in the nucleus in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Immunohistochemistry-Paraffin-NBP2-52917-img0014.jpg "Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human prostate shows strong granular cytoplasmic positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Immunohistochemistry-Paraffin-NBP2-52917-img0010.jpg "Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human prostate shows strong granular cytoplasmic positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human rectum shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Immunohistochemistry-Paraffin-NBP2-52917-img0011.jpg "Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human rectum shows strong cytoplasmic positivity in enteroendocrine cells.")
![Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/GDF-15-Antibody-CL0328-Immunohistochemistry-Paraffin-NBP2-52917-img0012.jpg "Immunohistochemistry-Paraffin: GDF-15 Antibody (CL0328) [NBP2-52917] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Immunocytochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunocytochemistry__Immunofluorescence_21145.jpg)
![Immunohistochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunohistochemistry_12968.jpg)
![N/A Hepcidin Antimicrobial Peptide [HRP]](https://images.novusbio.com/images2/Hepcidin_DHP250_ELISA_1121.jpg)
![N/A Hepcidin Antimicrobial Peptide [HRP]](https://images.novusbio.com/images2/Hepcidin_DHP250_ELISA_1122.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")