Novus Biologicals products are now on bio-techne.com

GAP-43 Recombinant Protein Antigen

Images

 
There are currently no images for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

GAP-43 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAP-43

Source: E. coli

Amino Acid Sequence: SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GAP43
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54671.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GAP-43 Recombinant Protein Antigen

  • Axonal membrane protein GAP-43
  • B-50
  • Basp2
  • calmodulin-binding protein P-57
  • GAP43
  • GAP-43
  • growth associated protein 43
  • Growth-associated protein 43
  • nerve growth-related peptide GAP43
  • Neural phosphoprotein B-50
  • Neuromodulin
  • neuron growth-associated protein 43
  • PP46
  • protein F1

Background

GAP43 (Growth associated protein 43) is a crucial component for regenerative response in the nervous system. GAP-43 is normally produced by neurons during developmental growth and axonal regeneration, but it is also expressed in specific regions of the normal adult nervous system. The protein is present at high levels in neuronal growth cones during development and axonal regeneration.

Heterozygous GAP3 knockout mice with GAP-43 levels reduced by one-half display significant memory impairments in cued conditioning, or on tests of nociceptive or auditory perception. Differentiating neurons that do not express GAP-43 show mislocalization of the centrosome and mitotic spindles, particularly in neurogenic cell divisions. Therefore, the neuronal precursor pool in the cerebellum fails to grow resulting in a cerebellum that is significantly smaller than normal. Total GAP-43 deletion is lethal within days of birth, demonstrating that GAP-43 is critical for the proper development of the mammalian CNS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
256-GF
Species: Hu
Applications: BA
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NB110-74751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
267-N3
Species: Hu
Applications: BA
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-54671PEP
Species: Hu
Applications: AC

Publications for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP) (0)

There are no publications for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP) (0)

There are no reviews for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAP-43 Products

Research Areas for GAP-43 Recombinant Protein Antigen (NBP2-54671PEP)

Find related products by research area.

Blogs on GAP-43.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

GAP-43 Antibody
NB300-143
MAP2 Antibody
NB300-213

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GAP-43 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GAP43