Novus Biologicals products are now on bio-techne.com

GADD45 alpha Recombinant Protein Antigen

Name: GADD45 alpha Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-55059PEP
Price: 289 USD

Submit a Review

Images

There are currently no images for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

GADD45 alpha Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GADD45 alpha. Source: E. coli Amino Acid Sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	GADD45A
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55059. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GADD45 alpha Recombinant Protein Antigen

DDIT-1
DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha
DNA damage-inducible transcript 1 protein
DNA damage-inducible transcript-1
GADD45 alpha
GADD45a
GADD45DNA-damage-inducible transcript 1
growth arrest and DNA-damage-inducible 45 alpha
growth arrest and DNA-damage-inducible, alpha

Background

GADD45A is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(43 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

TCEAL1 Antibody
(OTI2G10)

NBP2-46085

Species: Hu

Applications: IHC, IHC-P, WB

D4S234E Antibody
(1C3) - Azide and BSA ...

H00027065-M01

Western Blot D4S234E Antibody (1C3) - Azide and BSA Free

(1 Publication)

Species: Hu, Rt

Applications: ELISA, ICC/IF, S-ELISA, WB

PAK3 Antibody
[Unconjugated]

AF6897

Immunohistochemistry PAK3 Antibody [Unconjugated]

Species: Hu, Mu

Applications: IHC, Simple Western, WB

MYD118 Antibody

NBP3-12326

Immunohistochemistry-Paraffin MYD118 Antibody

Species: Hu, Mu, Pm, Rt

Applications: ELISA, IHC, IHC-P, IP, WB

GADD153/CHOP
Antibody (9C8) - BSA

NB600-1335

Flow Cytometry GADD153/CHOP Antibody (9C8) - BSA Free

Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8) - BSA Free

(3 Reviews)

(47 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

PCNA Antibody
(PC10) - BSA Free

NB500-106

Western Blot PCNA Antibody (PC10) - BSA Free

Flow Cytometry PCNA Antibody (PC10) - BSA Free

(5 Reviews)

(48 Publications)

Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze

Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

SLC12A9 Antibody -
BSA Free

NBP2-68858

Species: Hu

Applications: IHC, IHC-P

MDM2/HDM2 Antibody
(SMP14) - BSA Free

NB100-2736

Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free

(1 Review)

(22 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, IP, WB

Bcl-2 Antibody

NB100-56098

(2 Reviews)

(28 Publications)

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

GADD45G Antibody
(OTI2F12)

NBP2-45807

Immunohistochemistry GADD45G Antibody (OTI2F12)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

Bax Antibody (6A7)
- Azide and BSA Free

NBP1-28566

Immunohistochemistry-Frozen Bax Antibody (6A7) - Azide and BSA Free

(3 Reviews)

(21 Publications)

Species: Bv, Hu, Pm, Mu, Po, Rt

Applications: Func, IHC, IHC-Fr, IHC-P, WB

JNK1 Antibody
(228601) [Unconjugate

MAB17761

Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

c-jun [p Ser63]
Antibody (1018Y) [Unc ...

MAB8930

Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(394 Publications)

Species: Hu, Mu

Applications: ICC, IHC

CDC2/CDK1 Antibody
- BSA Free

NBP1-85729

Western Blot CDC2/CDK1 Antibody - BSA Free

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

p38 alpha Antibody
[Unconjugated]

AF8691

Western Blot p38 alpha Antibody [Unconjugated]

Immunohistochemistry p38 alpha Antibody [Unconjugated]

(1 Review)

(11 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, Simple Western, WB

GADD45 alpha
Recombinant Protein A ...

NBP2-55059PEP

Species: Hu

Applications: AC

Publications for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

There are no publications for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

There are no reviews for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GADD45 alpha Products

Research Areas for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP)

Find related products by research area.

Blogs on GADD45 alpha

There are no specific blogs for GADD45 alpha, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Caspase-3 Antibody [Unconjugated] - Active
AF835

Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.

PCNA Antibody (PC10) - BSA Free
NB500-106

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our GADD45 alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

GADD45A

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

GADD45 alpha Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

GADD45 alpha Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for GADD45 alpha Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

Reviews for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

FAQs for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP) (0)

Additional GADD45 alpha Products

Research Areas for GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP)

Blogs on GADD45 alpha

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics