GAD1/GAD67 Antibody (CL2919) [Alexa Fluor® 647] Summary
Immunogen |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS |
Isotype |
IgG2b |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GAD1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Protein A purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for GAD1/GAD67 Antibody (CL2919) [Alexa Fluor® 647]
Background
Glutamic Acid Decarboxylase (GAD) catalyzes the conversion of glutamate to gamma-aminobutyric acid (GABA). There are two known forms of GAD; GAD65 (65 kDa) and GAD67 (67 kDa) that are encoded by two different genes and appear to have distinct intraneuronal distribution in the brain. This antibody reacts with GAD67 and is predicted to react with GAD65.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Publications for GAD1/GAD67 Antibody (NBP2-46639AF647) (0)
There are no publications for GAD1/GAD67 Antibody (NBP2-46639AF647).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GAD1/GAD67 Antibody (NBP2-46639AF647) (0)
There are no reviews for GAD1/GAD67 Antibody (NBP2-46639AF647).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GAD1/GAD67 Antibody (NBP2-46639AF647) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GAD1/GAD67 Products
Research Areas for GAD1/GAD67 Antibody (NBP2-46639AF647)
Find related products by research area.
|
Blogs on GAD1/GAD67