![Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FRY-Antibody-Immunohistochemistry-Paraffin-NBP2-14510-img0006.jpg "Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVE |
| Predicted Species | Mouse (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FRY |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_VIII_AF2187_Western_Blot_20462.jpg)
![Simple Western Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_VIII_AF2187_Simple_Western_20463.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FRY |
![Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FRY-Antibody-Immunohistochemistry-Paraffin-NBP2-14510-img0001.jpg "Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FRY-Antibody-Immunohistochemistry-Paraffin-NBP2-14510-img0002.jpg "Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FRY-Antibody-Immunohistochemistry-Paraffin-NBP2-14510-img0003.jpg "Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/FRY-Antibody-Immunohistochemistry-Paraffin-NBP2-14510-img0004.jpg "Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/FRY-Antibody-Immunohistochemistry-Paraffin-NBP2-14510-img0005.jpg "Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")