![Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining in human pancreas and cerebral cortex tissues using anti-FKBP11 antibody. Corresponding FKBP11 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FKBP11-Antibody-Immunohistochemistry-Paraffin-NBP1-84678-img0017.jpg "Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining in human pancreas and cerebral cortex tissues using anti-FKBP11 antibody. Corresponding FKBP11 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FKBP11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FKBP11 |
![Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in mouse liver tissue and rat liver tissue.](http://images.novusbio.com/fullsize/FKBP11-Antibody-Western-Blot-NBP1-84678-img0014.jpg "Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in mouse liver tissue and rat liver tissue.")
![Immunocytochemistry/Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Staining of human cell line A-431 shows localization to centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FKBP11-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84678-img0013.jpg "Immunocytochemistry/Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Staining of human cell line A-431 shows localization to centrosome. Antibody staining is shown in green.")
![Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in human cell line Daudi.](http://images.novusbio.com/fullsize/FKBP11-Antibody-Western-Blot-NBP1-84678-img0011.jpg "Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in human cell line Daudi.")
![Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/FKBP11-Antibody-Immunohistochemistry-Paraffin-NBP1-84678-img0015.jpg "Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows high expression.](http://images.novusbio.com/fullsize/FKBP11-Antibody-Immunohistochemistry-Paraffin-NBP1-84678-img0016.jpg "Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows high expression.")
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Western_Blot_5411.jpg)
![Simple Western FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Simple_Western_16756.jpg)
![Immunohistochemistry FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Immunohistochemistry_22269.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")