![Western Blot: FGD1 Antibody [NBP3-03966] - Analysis of extracts of various cell lines, using FGD1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:ECL Basic Kit](http://images.novusbio.com/fullsize/FGD1-Antibody-Western-Blot-NBP3-03966-img0003.jpg "Western Blot: FGD1 Antibody [NBP3-03966] - Analysis of extracts of various cell lines, using FGD1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:ECL Basic Kit")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2). LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FGD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 106 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for FGD1 Antibody (NBP3-03966)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FGD1 |
![Immunocytochemistry/Immunofluorescence: FGD1 Antibody [NBP3-03966] - Analysis of L929 cells using FGD1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/FGD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03966-img0001.jpg "Immunocytochemistry/Immunofluorescence: FGD1 Antibody [NBP3-03966] - Analysis of L929 cells using FGD1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: FGD1 Antibody [NBP3-03966] - Mouse kidney using FGD1 antibody at dilution of 1:100 (40x lens)](http://images.novusbio.com/fullsize/FGD1-Antibody-Immunohistochemistry-Paraffin-NBP3-03966-img0005.jpg "Immunohistochemistry-Paraffin: FGD1 Antibody [NBP3-03966] - Mouse kidney using FGD1 antibody at dilution of 1:100 (40x lens)")
![Immunohistochemistry-Paraffin: FGD1 Antibody [NBP3-03966] - Paraffin-embedded rat kidney using FGD1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FGD1-Antibody-Immunohistochemistry-Paraffin-NBP3-03966-img0002.jpg "Immunohistochemistry-Paraffin: FGD1 Antibody [NBP3-03966] - Paraffin-embedded rat kidney using FGD1 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: FGD1 Antibody [NBP3-03966] - Human lung cancer using FGD1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FGD1-Antibody-Immunohistochemistry-Paraffin-NBP3-03966-img0004.jpg "Immunohistochemistry-Paraffin: FGD1 Antibody [NBP3-03966] - Human lung cancer using FGD1 antibody at dilution of 1:100 (40x lens).")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Immunocytochemistry CRIPTO Antibody [Unconjugated]](https://images.novusbio.com/images2/Cripto_AF1538_Immunocytochemistry__Immunofluorescence_20121.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")