![Western Blot: Ferredoxin Reductase Antibody [NBP2-38706] - Analysis using Anti-FDXR antibody NBP2-38706 (A) shows similar pattern to independent antibody NBP2-38530 (B).](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Western-Blot-NBP2-38706-img0010.jpg "Western Blot: Ferredoxin Reductase Antibody [NBP2-38706] - Analysis using Anti-FDXR antibody NBP2-38706 (A) shows similar pattern to independent antibody NBP2-38530 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FDXR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38706-img0003.jpg "Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining in human adrenal gland and lymph node tissues using NBP2-38706 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38706-img0019.jpg "Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining in human adrenal gland and lymph node tissues using NBP2-38706 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.")
![Western Blot: Ferredoxin Reductase Antibody [NBP2-38706] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Western-Blot-NBP2-38706-img0008.jpg "Western Blot: Ferredoxin Reductase Antibody [NBP2-38706] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38706-img0014.jpg "Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human adrenal gland, liver, lymph node and testis using Anti-FDXR antibody NBP2-38706 (A) shows similar protein distribution across tissues to independent antibody NBP2-38530 (B).](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38706-img0015.jpg "Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human adrenal gland, liver, lymph node and testis using Anti-FDXR antibody NBP2-38706 (A) shows similar protein distribution across tissues to independent antibody NBP2-38530 (B).")
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38706-img0016.jpg "Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38706-img0017.jpg "Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/Ferredoxin-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-38706-img0018.jpg "Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38706] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")