Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | FANCL (AAH54517, 1 a.a. - 375 a.a.) full-length human protein. MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADRVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNVIFGECPYCSKPITLKMSGRKH |
Specificity | FANCL - Fanconi anemia, complementation group L, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | FANCL |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against transfected lysate for western blot. It has also been used for ELISA and immunofluorescence. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00055120-B01P | Applications | Species |
---|---|---|
Panneerselvam J, Wang H, Zhang J et al. BLM promotes the activation of Fanconi Anemia signaling pathway. Oncotarget. 2016-04-12 [PMID: 27083049] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for FANCL Antibody (H00055120-B01P)Find related products by research area.
|
Fanconi Antibodies and Cancer Research We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.