![Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in control (vector only transfected HEK293T lysate) and EXOSC10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Western-Blot-NBP1-82448-img0010.jpg "Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in control (vector only transfected HEK293T lysate) and EXOSC10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EXOSC10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
| Publication using NBP1-82448 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EXOSC10 |
![Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Skin shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Immunohistochemistry-Paraffin-NBP1-82448-img0013.jpg "Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Skin shows moderate nuclear positivity in squamous epithelial cells.")
![Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EXOSC10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Western-Blot-NBP1-82448-img0009.jpg "Western Blot: Exosome component 10 Antibody [NBP1-82448] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EXOSC10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human esophagus shows strong nucleolar positivity in superficial squamous epithelial cells.](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Immunohistochemistry-Paraffin-NBP1-82448-img0007.jpg "Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human esophagus shows strong nucleolar positivity in superficial squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Immunohistochemistry-Paraffin-NBP1-82448-img0011.jpg "Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Cerebral cortex shows moderate nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Immunohistochemistry-Paraffin-NBP1-82448-img0012.jpg "Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts and leydig cells.](http://images.novusbio.com/fullsize/Exosome-component-10-Antibody-Immunohistochemistry-Paraffin-NBP1-82448-img0014.jpg "Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-82448] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts and leydig cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")