Novus Biologicals products are now on bio-techne.com

ERp57/PDIA3 Recombinant Protein Antigen

Images

 
There are currently no images for ERp57/PDIA3 Protein (NBP1-84796PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERp57/PDIA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDIA3.

Source: E. coli

Amino Acid Sequence: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDIA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84796.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERp57/PDIA3 Recombinant Protein Antigen

  • Disulfide isomerase ER-60
  • EC 5.3.4.1
  • endoplasmic reticulum P58
  • Endoplasmic reticulum resident protein 57
  • Endoplasmic reticulum resident protein 60
  • ER protein 60
  • ER60
  • ERp57
  • ERp5758 kDa glucose-regulated protein
  • ERp60
  • ERp6058 kDa microsomal protein
  • ERp61
  • glucose regulated protein, 58kDa
  • GRP57
  • GRP58
  • GRP58ER protein 57
  • HsT17083
  • P58
  • PDIA3
  • phospholipase C-alpha
  • PI-PLC
  • protein disulfide isomerase family A, member 3
  • protein disulfide isomerase-associated 3
  • protein disulfide-isomerase A3

Background

ERp57, also known as Glucose Regulated Protein 58 (Grp58), Hormone-Induced Protein-70 (HIP-70) and microsomal Carnitine Palmitoyltransferase, is a member of the protein disulfide isomerase family, containing two canonical CXHC tetrapeptide active site motifs (1-5). It has quite a few diverse roles. It functions as an accessory oxidoreductase involved in disulfide bond formation. In the ER, ERp57 interacts with membrane bound calnexin and soluble calreticulin (lectin chaperones) via their praline rich P-domain arms. Lectin chaperones bind nascent non-native glycoproteins, and position ERp57 to act upon the immature or misfolded glycoproteins that possess mono-glucosylated side chains. ERp57 deletion impairs posttranslational phases of influenza hema-glutinin folding, and causes accelerated release of MHC-I molecules, resulting in the coupling of sub-optimal peptides and reduced expression and stability on the cell surface (6). ERp57 also contains two thioredoxin active-site sequences, CGHC and an estrogen-binding domain. ERp57 is induced by both estrogen and leuteinizing-hormone-releasing hormone in the hippocampus (7).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52532
Species: Hu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
AF2364
Species: Hu
Applications: IHC, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP1-86968
Species: Hu
Applications: IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-49086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1543
Species: Hu
Applications: IHC, WB
H00008615-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ERp57/PDIA3 Protein (NBP1-84796PEP) (0)

There are no publications for ERp57/PDIA3 Protein (NBP1-84796PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERp57/PDIA3 Protein (NBP1-84796PEP) (0)

There are no reviews for ERp57/PDIA3 Protein (NBP1-84796PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERp57/PDIA3 Protein (NBP1-84796PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERp57/PDIA3 Products

Research Areas for ERp57/PDIA3 Protein (NBP1-84796PEP)

Find related products by research area.

Blogs on ERp57/PDIA3

There are no specific blogs for ERp57/PDIA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERp57/PDIA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA3