![Western Blot: ERLEC1 Antibody [NBP1-86801] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Western-Blot-NBP1-86801-img0005.jpg "Western Blot: ERLEC1 Antibody [NBP1-86801] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERLEC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERLEC1 |
![Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human cerebral cortex, colon, liver and testis using Anti-ERLEC1 antibody NBP1-86801 (A) shows similar protein distribution across tissues to independent antibody NBP1-86802 (B).](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86801-img0006.jpg "Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human cerebral cortex, colon, liver and testis using Anti-ERLEC1 antibody NBP1-86801 (A) shows similar protein distribution across tissues to independent antibody NBP1-86802 (B).")
![Western Blot: ERLEC1 Antibody [NBP1-86801] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-189](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Western-Blot-NBP1-86801-img0004.jpg "Western Blot: ERLEC1 Antibody [NBP1-86801] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-189")
![Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human liver using Anti-ERLEC1 antibody.](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86801-img0008.jpg "Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human liver using Anti-ERLEC1 antibody.")
![Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human colon using Anti-ERLEC1 antibody.](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86801-img0009.jpg "Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human colon using Anti-ERLEC1 antibody.")
![Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human cerebral cortex using Anti-ERLEC1 antibody.](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86801-img0010.jpg "Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human cerebral cortex using Anti-ERLEC1 antibody.")
![Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human testis using Anti-ERLEC1 antibody.](http://images.novusbio.com/fullsize/ERLEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-86801-img0011.jpg "Immunohistochemistry-Paraffin: ERLEC1 Antibody [NBP1-86801] - Staining of human testis using Anti-ERLEC1 antibody.")
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")