Novus Biologicals products are now on bio-techne.com

Erbin Recombinant Protein Antigen

Images

 
There are currently no images for Erbin Recombinant Protein Antigen (NBP2-56104PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Erbin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Erbin.

Source: E. coli

Amino Acid Sequence: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERBIN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56104.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Erbin Recombinant Protein Antigen

  • Densin-180-like protein
  • erbb2 interacting protein
  • Erbb2-interacting proteinErbin
  • ERBB2IP
  • Erbin
  • ERBINLAP2protein LAP2
  • KIAA1225

Background

The ERBB2IP gene encodes a LAP2 protein that exists in nine isoforms: Isoform 1: 1,412 amino acids long, 158 kDA; isoform 2: 1,371 amino acids long, 153 kDA; isoform 3: 1,360 amino acids long, 152 kDA; isoform 4: 1,346 amino acids, 151 kDA; isoform 5: 1,356 amino acids long, 152 kDA; isoform 6: 1,340 amino acids long, 150 kDA; isoform 7: 1,302 amino acids long, 146 kDA; isoform 8: 1,419 amino acids long, 159 kDA; isoform 9 is 1,367 amino acids long at 153 kDA. ERBB2IP functions as an adapter for the receptor ERBB2, and through binding of this receptor, it contributes to the stabilization of this unphosphorylated state. ERBB2IP participates in the NOD pathway, TGF-beta receptor signaling pathway, signal transduction, and with NLR proteins. It is known to interact with genes PKP4, SMAD3, ERBB2, ZFYVE9, and CTNNB1. ERBB2IP is associated with breast cancer, carcinoma, cervical cancer, crohn's disease, and epidermolysis bullosa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-04266
Species: Hu
Applications: ELISA, ICC/IF, WB
7754-BH/CF
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00008815-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-47403
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02211
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00008502-M01
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for Erbin Recombinant Protein Antigen (NBP2-56104PEP) (0)

There are no publications for Erbin Recombinant Protein Antigen (NBP2-56104PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Erbin Recombinant Protein Antigen (NBP2-56104PEP) (0)

There are no reviews for Erbin Recombinant Protein Antigen (NBP2-56104PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Erbin Recombinant Protein Antigen (NBP2-56104PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Erbin Products

Array NBP2-56104PEP

Blogs on Erbin

There are no specific blogs for Erbin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Erbin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBIN