![Immunocytochemistry/Immunofluorescence: Epiregulin Antibody (1E6) [H00002069-M01] - Analysis of monoclonal antibody to EREG on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Epiregulin-Antibody-1E6-Immunocytochemistry-Immunofluorescence-H00002069-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: Epiregulin Antibody (1E6) [H00002069-M01] - Analysis of monoclonal antibody to EREG on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA, ICC/IF |
| Clone | 1E6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE |
| Specificity | Reacts with epiregulin. |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | EREG |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against recombinant protein in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Epiregulin Antibody (H00002069-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: Epiregulin Antibody (1E6) [H00002069-M01] - Detection limit for recombinant GST tagged EREG is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Epiregulin-Antibody-1E6-Sandwich-ELISA-H00002069-M01-img0003.jpg "Sandwich ELISA: Epiregulin Antibody (1E6) [H00002069-M01] - Detection limit for recombinant GST tagged EREG is 0.1 ng/ml as a capture antibody.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Immunocytochemistry CRIPTO Antibody [Unconjugated]](https://images.novusbio.com/images2/Cripto_AF1538_Immunocytochemistry__Immunofluorescence_20121.jpg)
![Immunohistochemistry Betacellulin/BTC Antibody [Unconjugated]](https://images.novusbio.com/images2/Betacellulin_AF261NA_Immunohistochemistry_17238.jpg)
![Immunohistochemistry Betacellulin/BTC Antibody [Unconjugated]](https://images.novusbio.com/images2/Betacellulin_AF261NA_Immunohistochemistry_17368.jpg)
![Neutralization Betacellulin/BTC Antibody [Unconjugated]](https://images.novusbio.com/images2/Betacellulin_AF-261-NA_Block_Neutralize_8672.jpg)
![Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunocytochemistry__Immunofluorescence_17780.jpg)
![Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunohistochemistry_24179.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")