Novus Biologicals products are now on bio-techne.com

EPB41L1 Recombinant Protein Antigen

Name: EPB41L1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-31572PEP
Price: 289 USD

Images

There are currently no images for EPB41L1 Protein (NBP2-31572PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EPB41L1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EPB41L1. Source: E. coli Amino Acid Sequence: EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	EPB41L1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31572. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EPB41L1 Recombinant Protein Antigen

band 4.1-like protein 1
DKFZp686H17242
erythrocyte membrane protein band 4.1-like 1
KIAA0338Neuronal protein 4.1,4.1N
MGC11072
neuron-type nonerythroid protein 4.1

Background

Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The protein encoded by this gene is a neuronally-enriched protein that is structurally similar to EPB41. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EPB41 Antibody
(3D9)

H00002035-M01

Immunocytochemistry/ Immunofluorescence EPB41 Antibody (3D9)

Immunohistochemistry-Paraffin EPB41 Antibody (3D9)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

EPB41L3 Antibody -
BSA Free

NB110-61027

Western Blot EPB41L3 Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Pm, Rt, Xp

Applications: Simple Western, WB

EPB4IL2 Antibody

NBP1-06034

Immunocytochemistry/ Immunofluorescence EPB4IL2 Antibody

(1 Publication)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA

Glycophorin C
Antibody

NBP1-84597

Immunohistochemistry-Paraffin Glycophorin C Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Ezrin Antibody

NBP2-16396

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt, Ze

Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB

Calmodulin 2
Antibody

NBP2-14871

(1 Publication)

Species: Mu, Rt

Applications: ICC/IF, WB

Calmodulin
Antibody (2D1) - BSA

NB120-2860

(3 Publications)

Species: Ba, Bv, Ch, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Calmodulin 3
Antibody

NBP2-15669

Immunohistochemistry Whole-Mount Calmodulin 3 Antibody

(1 Publication)

Species: Mu, Rt, Ze

Applications: IHC-WhMt, IHC, WB

ERG Antibody - BSA
Free

NBP2-60655

Immunohistochemistry-Paraffin ERG Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

IP3R1 Antibody

NBP1-21398

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

MPP1 Antibody
(1E11-1G11)

H00004354-M01

Immunocytochemistry/ Immunofluorescence MPP1 Antibody (1E11-1G11)

Immunoprecipitation MPP1 Antibody (1E11-1G11)

(2 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IP, S-ELISA, WB

c-Fos Antibody
(2H2)

NBP2-50037

Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)

(1 Review)

(20 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, KO, WB

NF2/Merlin Antibody

NBP1-87757

Immunohistochemistry-Paraffin NF2/Merlin Antibody

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, KD, WB

Fascin Antibody
(833223) [Unconjugate

MAB7745

Knockout Validated Fascin Antibody (833223) [Unconjugated]

Immunohistochemistry Fascin Antibody (833223) [Unconjugated]

(2 Reviews)

Species: Hu

Applications: IHC, KO, Simple Western, WB

POLG2 Antibody -
BSA Free

NBP2-94064

Immunohistochemistry-Paraffin POLG2 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

CD25/IL-2R alpha
[HRP]

DR2A00

(36 Publications)

Species: Hu

Applications: ELISA

TNF RI/TNFRSF1A
[HRP]

DRT100

(86 Publications)

Species: Hu

Applications: ELISA

Protein Disulfide
Isomerase/P4HB Antibo ...

NB300-517

Immunocytochemistry/ Immunofluorescence Protein Disulfide Isomerase/P4HB Antibody (RL90)

(3 Reviews)

(28 Publications)

Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt

Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB

PSMD12 Antibody

NBP1-87801

Immunohistochemistry-Paraffin PSMD12 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

EPB41L1
Recombinant Protein A

NBP2-31572PEP

Species: Hu

Applications: AC

Publications for EPB41L1 Protein (NBP2-31572PEP) (0)

There are no publications for EPB41L1 Protein (NBP2-31572PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41L1 Protein (NBP2-31572PEP) (0)

There are no reviews for EPB41L1 Protein (NBP2-31572PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EPB41L1 Protein (NBP2-31572PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EPB41L1 Products

Blogs on EPB41L1

There are no specific blogs for EPB41L1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Protein Disulfide Isomerase/P4HB Antibody (RL90)
NB300-517

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our EPB41L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

EPB41L1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

EPB41L1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

EPB41L1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for EPB41L1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for EPB41L1 Protein (NBP2-31572PEP) (0)

Reviews for EPB41L1 Protein (NBP2-31572PEP) (0)

FAQs for EPB41L1 Protein (NBP2-31572PEP) (0)

Additional EPB41L1 Products

Blogs on EPB41L1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics