Home » ELL » ELL Proteins » ELL Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ELL Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ELL Protein (NBP2-13955PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ELL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELL.

Source: E. coli

Amino Acid Sequence: ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13955.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ELL Recombinant Protein Antigen

  • C19orf17
  • chromosome 19 open reading frame 17
  • DKFZp434I1916
  • Eleven-nineteen lysine-rich leukemia protein
  • ELL gene (11-19 lysine-rich leukemia gene)
  • ELL1
  • elongation factor RNA polymerase II
  • MEN
  • RNA polymerase II elongation factor ELL

Background

Eleven-nineteen lysine-rich leukemia protein (ELL) was originally identified in a screen for genes that fuse to MLL (myeloid-lymphoid leukemia) in the t(11;19)(q23;p13.1) breakpoint. ELL is an elongation factor that increases the catalytic rate of RNA pol II by suppressing transient pausing of RNA pol II. ELL has been shown to be essential to development and important to cell growth and survival. Alternate names for ELL include RNA polymerase II elongation factor ELL, ELL1, and men.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Menin Antibody
NB100-215
Immunoprecipitation Menin Antibody
Western Blot Menin Antibody
Western Blot Menin Antibody
(26 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
TrkA Antibody
[Unconjugated]
AF1056
Immunohistochemistry TrkA Antibody [Unconjugated]
Western Blot TrkA Antibody [Unconjugated]
Immunohistochemistry TrkA Antibody [Unconjugated]
(44 Publications)
Species: Rt
Applications: IHC, WB
Recombinant Human
Metallothionein-1A GS ...
H00004489-P01
SDS-PAGE Recombinant Human Metallothionein-1A GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
gamma-Synuclein
Antibody
NBP1-89996
Western Blot gamma-Synuclein Antibody
Immunohistochemistry-Paraffin gamma-Synuclein Antibody
Immunohistochemistry gamma-Synuclein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
NBP1-86125
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Gastrin Antibody
NBP3-12223
Immunohistochemistry-Paraffin Gastrin Antibody
Unknown Gastrin Antibody
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Von Hippel Lindau
Antibody (OTI1E1)
NBP2-45411
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
CDC14 Antibody
(472508) [Unconjugate
MAB4457
Western Blot CDC14 Antibody (472508) [Unconjugated]
Western Blot CDC14 Antibody (472508) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB

beta-1,3-Glucuronyltra ...
NBP1-19788
Immunocytochemistry/ Immunofluorescence beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free
Immunohistochemistry beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
ELL Recombinant
Protein Antigen
NBP2-13955PEP
ELL Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ELL Protein (NBP2-13955PEP) (0)

There are no publications for ELL Protein (NBP2-13955PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELL Protein (NBP2-13955PEP) (0)

There are no reviews for ELL Protein (NBP2-13955PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ELL Protein (NBP2-13955PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELL Products

Array NBP2-13955PEP

Research Areas for ELL Protein (NBP2-13955PEP)

Find related products by research area.

Blogs on ELL

There are no specific blogs for ELL, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELL Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ELL