Home » ELF3/ESE-1 » ELF3 Peptides and Proteins » Recombinant Human ELF3/ESE-1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human ELF3/ESE-1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human ELF3/ESE-1 Protein [H00001999-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human ELF3/ESE-1 Protein [H00001999-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human ELF3/ESE-1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 262-371 of Human ELF3/ESE-1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ELF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELF3/ESE-1 GST (N-Term) Protein

  • E74-like factor 3 (ets domain transcription factor, epithelial-specific )
  • E74-like factor 3
  • ELF3
  • Epithelial-restricted with serine box
  • epithelial-specific)
  • Epithelium-restricted Ets protein ESX
  • Epithelium-specific Ets transcription factor 1
  • EPR1
  • EPR-1
  • ERT
  • ESX
  • ets domain transcription factor, serine box (epithelial-specific)
  • ETS-related transcription factor Elf-3
  • JEN
  • serine box

Background

ELF3 - E74-like factor 3 (ets domain transcription factor, epithelial-specific )

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


alpha-Galactosidase A/ ...
6146-GH
Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]
Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]
SDS-PAGE alpha-Galactosidase A/GLA [Unconjugated]
(3 Publications)
Species: Hu
Applications: EnzAct

Glucosylceramidase/GBA ...
MAB7410
Simple Western Glucosylceramidase/GBA Antibody (812201) [Unconjugated]
Western Blot Glucosylceramidase/GBA Antibody (812201) [Unconjugated]
Immunocytochemistry Glucosylceramidase/GBA Antibody (812201) [Unconjugated]
(7 Publications)
Species: Hu
Applications: ICC, KO, Simple Western, WB
LYAG/GAA Antibody
NBP2-38142
Western Blot LYAG/GAA Antibody
Immunohistochemistry-Paraffin LYAG/GAA Antibody
Immunohistochemistry-Paraffin LYAG/GAA Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western Blot Ets-1 Antibody [Unconjugated]
Immunohistochemistry Ets-1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, WB
Coagulation Factor
X Antibody
NBP1-33320
Western Blot Coagulation Factor X Antibody
Immunocytochemistry/ Immunofluorescence Coagulation Factor X Antibody
Immunohistochemistry-Paraffin Coagulation Factor X Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Knockout Validated Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(49 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Recombinant Human
ELF3/ESE-1 GST (N-Ter ...
H00001999-Q01
Recombinant Human ELF3/ESE-1 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01) (0)

There are no publications for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01) (0)

There are no reviews for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELF3/ESE-1 Products

Research Areas for ELF3/ESE-1 Partial Recombinant Protein (H00001999-Q01)

Find related products by research area.

Blogs on ELF3/ESE-1

There are no specific blogs for ELF3/ESE-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ELF3/ESE-1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ELF3