Home » EIF2 beta » EIF2 beta Proteins » Recombinant Human EIF2 beta GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human EIF2 beta GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human EIF2 beta Protein [H00008894-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human EIF2 beta Protein [H00008894-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human EIF2 beta GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human EIF2S2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
EIF2S2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
64.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EIF2 beta GST (N-Term) Protein

  • DKFZp686L18198
  • EIF2
  • EIF2B
  • EIF2beta
  • eIF-2-beta
  • eukaryotic initiation factor 2-beta
  • eukaryotic translation initiation factor 2 beta
  • eukaryotic translation initiation factor 2 subunit 2
  • Eukaryotic translation initiation factor 2 subunit beta
  • eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • MGC8508

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

eIF2B epsilon
Antibody (5M2D4)
NBP3-16674
Western Blot eIF2B epsilon Antibody (5M2D4)
Immunohistochemistry-Paraffin eIF2B epsilon Antibody (5M2D4)
Immunohistochemistry-Paraffin eIF2B epsilon Antibody (5M2D4)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
eIF4E [p Ser209]
Antibody - BSA Free
NB100-81898
Western Blot eIF4E [p Ser209] Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody - BSA Free
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody - BSA Free
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
4EBP1 Antibody -
BSA Free
NB200-157
Western Blot 4EBP1 Antibody - BSA Free
Western Blot 4EBP1 Antibody - BSA Free
Western Blot 4EBP1 Antibody - BSA Free
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
eIF4G1 Antibody -
BSA Free
NB100-268
Western Blot eIF4G1 Antibody - BSA Free
Immunoprecipitation eIF4G1 Antibody - BSA Free
(26 Publications)
Species: Hu, Po
Applications: IP, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western Blot SOS2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
Tbp7 Antibody -
BSA Free
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody - BSA Free
Western Blot Tbp7 Antibody - BSA Free
Western Blot Tbp7 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TOR/mTOR [p
Ser2448] Antibody - B ...
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody - BSA Free
Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free
Data TOR/mTOR [p Ser2448] Antibody - BSA Free
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
EIF5 Antibody
NBP2-16311
Western Blot EIF5 Antibody
Immunohistochemistry-Paraffin EIF5 Antibody
Western Blot EIF5 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
eIF4A2 Antibody
NBP2-24529
Western Blot eIF4A2 Antibody
Immunohistochemistry-Paraffin eIF4A2 Antibody
Simple Western eIF4A2 Antibody
(1 Review)
(1 Publication)
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
GEF-H1 Antibody -
BSA Free
NBP2-21577
Western Blot GEF-H1 Antibody - BSA Free
Western Blot GEF-H1 Antibody - BSA Free
Western Blot GEF-H1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10) - Azide and BS ...
H00056731-M02
Western Blot SLC2A4RG Antibody (4C10) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SLC2A4RG Antibody (4C10) - Azide and BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ACOT12 Antibody
(OTI1A11)
NBP2-03605
Flow Cytometry ACOT12 Antibody (OTI1A11)
Flow Cytometry ACOT12 Antibody (OTI1A11)
Western Blot ACOT12 Antibody (OTI1A11)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA

Publications for EIF2 beta Recombinant Protein (H00008894-P01) (0)

There are no publications for EIF2 beta Recombinant Protein (H00008894-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2 beta Recombinant Protein (H00008894-P01) (0)

There are no reviews for EIF2 beta Recombinant Protein (H00008894-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF2 beta Recombinant Protein (H00008894-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EIF2 beta Products

Research Areas for EIF2 beta Recombinant Protein (H00008894-P01)

Find related products by research area.

Blogs on EIF2 beta

There are no specific blogs for EIF2 beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EIF2 beta GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol EIF2S2