Home » EDEM2 » EDEM2 Proteins » EDEM2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

EDEM2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EDEM2 Protein (NBP2-37921PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EDEM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDEM2.

Source: E. coli

Amino Acid Sequence: FDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQRLKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EDEM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37921.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EDEM2 Recombinant Protein Antigen

  • bA4204.1
  • C20orf31
  • C20orf49
  • chromosome 20 open reading frame 31
  • ER degradation enhancer, mannosidase alpha-like 2
  • ER degradation-enhancing alpha-mannosidase-like 2
  • ER degradation-enhancing-mannosidase-like protein 2
  • FLJ10783

Background

In the endoplasmic reticulum (ER), misfolded proteins are retrotranslocated to the cytosol and degraded by the proteasome in a process known as ER-associated degradation (ERAD). EDEM2 belongs to a family of proteins involved in ERAD of glycoproteins (Mast et al., 2005 [PubMed 15537790]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
EDEM1 GST (N-Term) Pr ...
H00009695-Q01
SDS-PAGE Recombinant Human EDEM1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
EPCR Antibody
[Unconjugated]
AF2245
Western Blot EPCR Antibody [Unconjugated]
Immunohistochemistry EPCR Antibody [Unconjugated]
(17 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Prosurfactant
Protein C Antibody
NBP1-87201
Western Blot Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
XBP1 Antibody -
BSA Free
NBP1-77681
Immunohistochemistry XBP1 Antibody - BSA Free
Flow Cytometry XBP1 Antibody - BSA Free
Flow Cytometry XBP1 Antibody - BSA Free
(18 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(43 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
EDEM3 Antibody
NBP1-88342
Immunohistochemistry-Paraffin EDEM3 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Calnexin Antibody
- BSA Free
NB100-1965
Western Blot Calnexin Antibody - BSA Free
Immunohistochemistry Calnexin Antibody - BSA Free
Immunohistochemistry Calnexin Antibody - BSA Free
(3 Reviews)
(45 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
ERLEC1 Antibody
NBP1-86801
Western Blot ERLEC1 Antibody
Immunohistochemistry-Paraffin ERLEC1 Antibody
Immunohistochemistry-Paraffin ERLEC1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Derlin 1 Antibody
NB100-448
Immunocytochemistry/ Immunofluorescence Derlin 1 Antibody
Western Blot Derlin 1 Antibody
Immunohistochemistry Derlin 1 Antibody
(2 Publications)
Species: Ca, ChHa, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot GADD153/CHOP Antibody (9C8)
Flow Cytometry GADD153/CHOP Antibody (9C8)
Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)
(3 Reviews)
(46 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

Thrombomodulin/BDCA-3 ...
AF3894
Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]
Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]
(14 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Recombinant Human
Derlin-3 GST (N-Term) ...
H00091319-P01
Other Recombinant Human Derlin-3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
ERN2 Antibody
NBP3-17487
Immunohistochemistry-Paraffin ERN2 Antibody
Species: Hu
Applications: IHC, IHC-P
IRE1 alpha [p
Ser724] Antibody - BS ...
NB100-2323
Immunohistochemistry-Paraffin IRE1 alpha [p Ser724] Antibody - BSA Free
Western Blot IRE1 alpha [p Ser724] Antibody - BSA Free
Western Blot IRE1 alpha [p Ser724] Antibody - BSA Free
(9 Reviews)
(335 Publications)
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, Simple Western, WB
Derlin-2 Antibody
NBP2-47485
Western Blot Derlin-2 Antibody
Immunohistochemistry-Paraffin Derlin-2 Antibody
Immunohistochemistry-Paraffin Derlin-2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
p97/VCP Antibody
NB100-1558
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
Western Blot p97/VCP Antibody
(12 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin Kininogen Antibody
Immunohistochemistry-Paraffin Kininogen Antibody
Western Blot Kininogen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA

Publications for EDEM2 Protein (NBP2-37921PEP) (0)

There are no publications for EDEM2 Protein (NBP2-37921PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDEM2 Protein (NBP2-37921PEP) (0)

There are no reviews for EDEM2 Protein (NBP2-37921PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EDEM2 Protein (NBP2-37921PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDEM2 Products

Research Areas for EDEM2 Protein (NBP2-37921PEP)

Find related products by research area.

Blogs on EDEM2

There are no specific blogs for EDEM2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

IRE1 (pS724) was detected in immersion fixed paraffin-embedded sections of human spleen using Rabbit Anti-Human IRE1 (pS724) polyclonal Antibody (Catalog # NB100-2323) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the perinuclear cytoplasm in splenocytes.
IRE1 alpha [p Ser724] Antibody - BSA Free
NB100-2323
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
GADD153/CHOP Antibody (9C8)
NB600-1335

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EDEM2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EDEM2