Novus Biologicals products are now on bio-techne.com

Recombinant Human EDEM1 GST (N-Term) Protein

Name: Recombinant Human EDEM1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00009695-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

SDS-Page: Recombinant Human EDEM1 Protein [H00009695-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human EDEM1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 559-656 of Human EDEM1 Source: Wheat Germ (in vitro) Amino Acid Sequence: YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	EDEM1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array SDS-Page Western Blot
Theoretical MW	36.52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EDEM1 GST (N-Term) Protein

EDEMKIAA0212ER degradation-enhancing alpha-mannosidase-like 1
ER degradation enhancer, mannosidase alpha-like 1
FLJ51559
FLJ51560

Background

Extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner. It lacks mannosidase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GRP78/HSPA5
Antibody - BSA Free

NBP1-06274

Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free

(2 Reviews)

(44 Publications)

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze

Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

ATF6 Antibody
(70B1413.1) - BSA Fre

NBP1-40256

Flow (Intracellular) ATF6 Antibody (70B1413.1) - BSA Free

Immunohistochemistry-Paraffin ATF6 Antibody (70B1413.1) - BSA Free

(3 Reviews)

(246 Publications)

Species: Hu, Mu, Pl, Po, Rb, Rt

Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB

XBP1 Antibody -
BSA Free

NBP1-77681

(18 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB

Calnexin Antibody
- BSA Free

NB100-1965

Immunohistochemistry Calnexin Antibody - BSA Free

(3 Reviews)

(46 Publications)

Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze

Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

BMP-3b/GDF-10
Antibody [Unconjugate

AF1543

(1 Publication)

Species: Hu

Applications: IHC, WB

GADD153/CHOP
Antibody (9C8)

NB600-1335

Flow Cytometry GADD153/CHOP Antibody (9C8)

Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)

(3 Reviews)

(46 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

IRE1 alpha [p
Ser724] Antibody - BS ...

NB100-2323

Western Blot IRE1 alpha [p Ser724] Antibody - BSA Free

(9 Reviews)

(337 Publications)

Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt

Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, Simple Western, WB

ERN2 Antibody

NBP3-17487

Species: Hu

Applications: IHC, IHC-P

DNAJC10 Antibody
(3C4)

H00054431-M01

Immunohistochemistry-Paraffin DNAJC10 Antibody (3C4)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

DNAJC3 Antibody

NBP2-48704

Immunohistochemistry-Paraffin DNAJC3 Antibody

Immunocytochemistry/ Immunofluorescence DNAJC3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Calreticulin
Antibody - BSA Free

NB600-101

Western Blot Calreticulin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free

(28 Publications)

Species: Bv, Ha, Hu, Mu, Pm, Rt

Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB

ERp57/PDIA3
Antibody

NBP1-84796

Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

Derlin 1 Antibody

NB100-448

(2 Publications)

Species: Ca, ChHa, Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

OS9 Antibody

BC100-520

Immunocytochemistry/ Immunofluorescence OS9 Antibody

(1 Review)

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, Simple Western, WB

PERK Antibody
[Unconjugated]

AF3999

Knockout Validated PERK Antibody [Unconjugated]

(7 Publications)

Species: Hu

Applications: KO, WB

EDEM2 Antibody
(2E4)

H00055741-M01

Immunohistochemistry-Paraffin EDEM2 Antibody (2E4)

Immunoprecipitation EDEM2 Antibody (2E4)

Species: Hu

Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB

gp96/HSP90B1/GRP94
Antibody (9G10)

NB300-619

(2 Reviews)

(5 Publications)

Species: Bv, Ch, Ha, Hu, Mu, Rt

Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB

KIR2DL3/CD158b2
Antibody (180701) [Un ...

MAB2014

(12 Publications)

Species: Hu

Applications: CyTOF-reported, Flow

EDEM3 Antibody

NBP1-88342

(3 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

DNA Primase large
subunit Antibody - Az ...

NBP2-92044

Species: Hu, Mu

Applications: WB

Publications for EDEM1 Partial Recombinant Protein (H00009695-Q01) (0)

There are no publications for EDEM1 Partial Recombinant Protein (H00009695-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDEM1 Partial Recombinant Protein (H00009695-Q01) (0)

There are no reviews for EDEM1 Partial Recombinant Protein (H00009695-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EDEM1 Partial Recombinant Protein (H00009695-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDEM1 Products

Research Areas for EDEM1 Partial Recombinant Protein (H00009695-Q01)

Find related products by research area.

Lipid and Metabolism

Blogs on EDEM1

There are no specific blogs for EDEM1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

IRE1 (pS724) was detected in immersion fixed paraffin-embedded sections of human spleen using Rabbit Anti-Human IRE1 (pS724) polyclonal Antibody (Catalog # NB100-2323) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the perinuclear cytoplasm in splenocytes.

IRE1 alpha [p Ser724] Antibody - BSA Free
NB100-2323

Western Blot: ATF6 Antibody (70B1413.1) [NBP1-40256] - Hypoxia leads to EMT and ER-stress in CRC cells. B. C. Confluent growing SW480 (B) and HCT116 (C) cells were cultured under conditions of normoxia or hypoxia-like conditions (serum free; 100 uM CoCl2, 1-9 h. B-actin (B-act) as loading control. HIF1a was detectable after 3 h of CoCl2 incubation, the amount of the 50 kD-ATF6 fragment, was already enhanced after 1 h of addition of CoCl2. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0087386) licensed under a CC-BY license.

ATF6 Antibody (70B1413.1) - BSA Free
NBP1-40256-0.1mg

$Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Citeab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY license.$

Calnexin Antibody - BSA Free
NB100-1965

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human EDEM1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

EDEM1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human EDEM1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human EDEM1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human EDEM1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for EDEM1 Partial Recombinant Protein (H00009695-Q01) (0)

Reviews for EDEM1 Partial Recombinant Protein (H00009695-Q01) (0)

Product General Protocols

Video Protocols

FAQs for EDEM1 Partial Recombinant Protein (H00009695-Q01) (0)

Additional EDEM1 Products

Research Areas for EDEM1 Partial Recombinant Protein (H00009695-Q01)

Blogs on EDEM1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics