![Western Blot: DSCAM Antibody [NBP1-59208] - Amount and Sample Type : 10 cm sq plate myc-DSCAM transfected mouse neuro2a cells Primary Antibody : DSCAM Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-Rabbit HRP Secondary Antibody Dilution : 1:5000 Gene Name : DSCAM](http://images.novusbio.com/fullsize/DSCAM-Antibody-Western-Blot-NBP1-59208-img0005.jpg "Western Blot: DSCAM Antibody [NBP1-59208] - Amount and Sample Type : 10 cm sq plate myc-DSCAM transfected mouse neuro2a cells Primary Antibody : DSCAM Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-Rabbit HRP Secondary Antibody Dilution : 1:5000 Gene Name : DSCAM")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to DSCAM(Down syndrome cell adhesion molecule) The peptide sequence was selected from the middle region of DSCAM (NP_001380). Peptide sequence MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DSCAM |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 30206355). |
|
| Theoretical MW | 222 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Untangling the contribution of the enteric nervous system to intestinal and extraintestinal disease By Emily Cartwright, PhD What is the ENS?When it's late in the afternoon and you smell a delicious bag of popcorn in the microwave, your mouth begins to water and your stomach starts to grumble. These behaviors ar... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: DSCAM Antibody [NBP1-59208] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://images.novusbio.com/fullsize/DSCAM-Antibody-Western-Blot-NBP1-59208-img0003.jpg "Western Blot: DSCAM Antibody [NBP1-59208] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.")
![Flow Cytometry DSCAM-L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DSCAM-L1_AF3315_Flow_Cytometry_8197.jpg)
![Immunohistochemistry DCC Antibody [Unconjugated]](https://images.novusbio.com/images2/af844_mouse-dcc-affinity-purified-polyclonal-ab-immunohistochemistry-21102022151713.jpg)
![SDS-PAGE Netrin-1 [Unconjugated]](https://images.novusbio.com/images2/Netrin-1_1109-N1_779.jpg)
![Western Blot Contactin-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-6_AF5890_Western_Blot_10481.jpg)
![Immunohistochemistry Contactin-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-6_AF5890_Immunohistochemistry_10507.jpg)
![Simple Western Contactin-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin6_AF5890_Simple_Western_17653.jpg)
![Western Blot Carbonic Anhydrase III/CA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_III_AF2185_Western_Blot_20454.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")