![Western Blot: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Western blot analysis of lysates from Jurkat cells using GSDME Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.](http://images.novusbio.com/fullsize/nbp2-92914_rabbit-polyclonal-dfna5-deafness-antibody-42202514251887.jpg "Western Blot: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Western blot analysis of lysates from Jurkat cells using GSDME Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-270 of human Dfna5 (NP_004394.1). MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSDME |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
![Cochlin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Cochlin [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Dfna5 Antibody (NBP2-92914)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSDME |
![Western Blot: Dfna5 Antibody [NBP2-92914] -Analysis of various lysates using GSDME Rabbit pAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp2-92914_rabbit-polyclonal-dfna5-deafness-antibody-western-blot-191120248429..png "Western Blot: Dfna5 Antibody [NBP2-92914] -Analysis of various lysates using GSDME Rabbit pAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.")
![Immunohistochemistry-Paraffin: Dfna5 Antibody [NBP2-92914] - Human pancreatic panniculitis using DFNA5/GSDME Rabbit pAb at dilution of 1:50 (40x lens).](http://images.novusbio.com/fullsize/Dfna5-Antibody-Immunohistochemistry-Paraffin-NBP2-92914-img0007.jpg "Immunohistochemistry-Paraffin: Dfna5 Antibody [NBP2-92914] - Human pancreatic panniculitis using DFNA5/GSDME Rabbit pAb at dilution of 1:50 (40x lens).")
![Immunohistochemistry-Paraffin: Dfna5 Antibody [NBP2-92914] - Human pulmonary tuberculosis using DFNA5/GSDME Rabbit pAb at dilution of 1:50 (40x lens).](http://images.novusbio.com/fullsize/Dfna5-Antibody-Immunohistochemistry-Paraffin-NBP2-92914-img0006.jpg "Immunohistochemistry-Paraffin: Dfna5 Antibody [NBP2-92914] - Human pulmonary tuberculosis using DFNA5/GSDME Rabbit pAb at dilution of 1:50 (40x lens).")
![Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of NIH/3T3 cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92914_rabbit-polyclonal-dfna5-deafness-antibody-4220251430420.jpg "Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of NIH/3T3 cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of PC-12 cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92914_rabbit-polyclonal-dfna5-deafness-antibody-42202514275254.jpg "Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of PC-12 cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of U2OS cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92914_rabbit-polyclonal-dfna5-deafness-antibody-4220251429099.jpg "Immunocytochemistry/ Immunofluorescence: Dfna5 Antibody - Azide and BSA Free [NBP2-92914] - Immunofluorescence analysis of U2OS cells using GSDME Rabbit pAb at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")