![Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Analysis in human skin and liver tissues using NBP2-31886 antibody. Corresponding Desmocollin-3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Desmocollin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-31886-img0007.jpg "Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Analysis in human skin and liver tissues using NBP2-31886 antibody. Corresponding Desmocollin-3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DSC3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-31886 | Applications | Species |
|---|---|---|
| Zhan C, Yan L, Wang L et al. Identification of immunohistochemical markers for distinguishing lung adenocarcinoma from squamous cell carcinoma. J Thorac Dis 2015-08-01 [PMID: 26380766] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human liver shows no membranous postivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Desmocollin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-31886-img0012.jpg "Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human liver shows no membranous postivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human esophagus shows high expression.](http://images.novusbio.com/fullsize/Desmocollin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-31886-img0004.jpg "Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human esophagus shows high expression.")
![Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Desmocollin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-31886-img0009.jpg "Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human tonsil shows moderate membranous positivity in squamous epithelial cells and non-germinal center cells.](http://images.novusbio.com/fullsize/Desmocollin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-31886-img0010.jpg "Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human tonsil shows moderate membranous positivity in squamous epithelial cells and non-germinal center cells.")
![Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human placenta shows moderate membranous postivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Desmocollin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-31886-img0011.jpg "Immunohistochemistry-Paraffin: Desmocollin-3 Antibody [NBP2-31886] - Staining of human placenta shows moderate membranous postivity in trophoblastic cells.")
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![Simple Western Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Simple_Western_20740.jpg)
![Western Blot Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Western_Blot_20147.jpg)
![Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunocytochemistry__Immunofluorescence_17780.jpg)
![Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunohistochemistry_24179.jpg)
![Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R3_AF743_Flow_Cytometry_15754.jpg)
![Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af743_mouse-vegf-r3-flt-4-affinity-purified-polyclonal-ab-41202410325571.jpg)
![Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af743_mouse-vegf-r3-flt-4-affinity-purified-polyclonal-ab-41202410325534.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")