![Western Blot: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Analysis in control (vector only transfected HEK293T lysate) and DEPTOR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/DEPTOR-DEPDC6-Antibody-Western-Blot-NBP1-85257-img0010.jpg "Western Blot: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Analysis in control (vector only transfected HEK293T lysate) and DEPTOR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSV |
| Predicted Species | Mouse (98%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DEPTOR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 46 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DEPTOR/DEPDC6 Antibody (NBP1-85257)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, mitochondria & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DEPTOR-DEPDC6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85257-img0006.jpg "Immunocytochemistry/Immunofluorescence: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, mitochondria & cell junctions. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/DEPTOR-DEPDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85257-img0009.jpg "Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/DEPTOR-DEPDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85257-img0007.jpg "Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/DEPTOR-DEPDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85257-img0008.jpg "Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85257] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Immunocytochemistry/ Immunofluorescence p70 S6 Kinase/S6K [p Thr389/412] Antibody](https://images.novusbio.com/images/p70-S6-Kinase-S6K-[p-Thr389]-Antibody-Immunocytochemistry-Immunofluorescence-NB600-1049-img0002.jpg)
![Immunohistochemistry p70 S6 Kinase/S6K [p Thr389/412] Antibody](https://images.novusbio.com/images/p70-S6-Kinase-S6K-[p-Thr389]-Antibody-Immunohistochemistry-NB600-1049-img0003.jpg)
![Western Blot p70 S6 Kinase/S6K [p Thr389/412] Antibody](https://images.novusbio.com/images/p70-S6-Kinase-S6K-[p-Thr389]-Antibody-Western-Blot-NB600-1049-img0004.jpg)
![SCF/c-kit Ligand [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SCF/c-kit Ligand [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")