![Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Analysis in human fallopian tube and skeletal muscle tissues using NBP2-38184 antibody. Corresponding DCDC2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp2-38184_rabbit-polyclonal-dcdc2-antibody-immunohistochemistry-paraffin-202202563156..png "Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Analysis in human fallopian tube and skeletal muscle tissues using NBP2-38184 antibody. Corresponding DCDC2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCDC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![SECTM1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SECTM1 [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for DCDC2 Antibody (NBP2-38184)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: DCDC2 Antibody [NBP2-38184] - Staining of human cell line RPTEC TERT1 shows localization to nucleoplasm, cytosol, microtubule organizing center & mitotic spindle. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DCDC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38184-img0010.jpg "Immunocytochemistry/Immunofluorescence: DCDC2 Antibody [NBP2-38184] - Staining of human cell line RPTEC TERT1 shows localization to nucleoplasm, cytosol, microtubule organizing center & mitotic spindle. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-38184_rabbit-polyclonal-dcdc2-antibody-immunohistochemistry-paraffin-20220256332..png "Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human kidney shows strong cytoplasmic positivity in Bowman's capsule and cells in distal tubules.](http://images.novusbio.com/fullsize/antibody/nbp2-38184_rabbit-polyclonal-dcdc2-antibody-immunohistochemistry-paraffin-202202563352..png "Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human kidney shows strong cytoplasmic positivity in Bowman's capsule and cells in distal tubules.")
![Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human fallopian tube shows strong positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-38184_rabbit-polyclonal-dcdc2-antibody-immunohistochemistry-paraffin-202202563444..png "Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human fallopian tube shows strong positivity in cilia in glandular cells.")
![Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-38184_rabbit-polyclonal-dcdc2-antibody-immunohistochemistry-paraffin-202202563533..png "Immunohistochemistry-Paraffin: DCDC2 Antibody [NBP2-38184] -Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")