Home » Cytosolic Sulfotransferase 2B1/SULT2B1 » SULT2B1 Peptides and Proteins » Cytosolic Sulfotransferase 2B1/SULT2B1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Cytosolic Sulfotransferase 2B1/SULT2B1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Cytosolic Sulfotransferase 2B1/SULT2B1 Protein (NBP2-33396PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Cytosolic Sulfotransferase 2B1/SULT2B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SULT2B1.

Source: E. coli

Amino Acid Sequence: GLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SULT2B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33396.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cytosolic Sulfotransferase 2B1/SULT2B1 Recombinant Protein Antigen

  • Alcohol sulfotransferase
  • Cytosolic Sulfotransferase 2B1
  • EC 2.8.2
  • EC 2.8.2.2
  • HSST2
  • HSST2sulfotransferase family cytosolic 2B member 1
  • Hydroxysteroid sulfotransferase 2
  • ST2B1
  • Sulfotransferase 2B1
  • sulfotransferase family, cytosolic, 2B, member 1
  • SULT2B1

Background

Sulfotransferase family cytosolic 2B member 1 isoform b, also known as SULT2B1, is a member of Sulfotransferase family. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. SULT2B1b is localized in the cytosol and nuclei of human cells. SULT2B1b is selective for the sulfation of 3beta-hydroxysteroids such as dehydroepiandrosterone and pregnenolone, and may also have a role in cholesterol sulfation in human skin. Recombinant human SULT2B1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Regucalcin Antibody
NBP1-80849
Western Blot Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Cytosolic
Sulfotransferase 2A1/ ...
AF5828
Immunocytochemistry Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Western Blot Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Species: Hu
Applications: ICC, Neut, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Cytosolic
Sulfotransferase 1E1/ ...
MAB5545
Western Blot Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (726211)
(1 Review)
(1 Publication)
Species: Hu
Applications: WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
Cytosolic
Sulfotransferase 1A1/ ...
NBP2-03227
Flow Cytometry Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (OTI9B7)
Flow Cytometry Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (OTI9B7)
Western Blot Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody (OTI9B7)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA Histatin 3 Antibody (4G9)
Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
FGF-4
[Unconjugated]
7460-F4/CF
FGF-4 [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
FXR/NR1H4 Antibody
(A9033A) [Unconjugate ...
PP-A9033A-00
FXR/NR1H4 Antibody (A9033A) [Unconjugated]
(2 Reviews)
(13 Publications)
Species: Hu
Applications: DirELISA, IHC, IP, WB
NDST3 Antibody
NBP2-19501
Western Blot NDST3 Antibody
Immunohistochemistry-Paraffin NDST3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
RNF23 Antibody
NBP2-20183
Immunohistochemistry-Paraffin RNF23 Antibody
Western Blot RNF23 Antibody
Western Blot RNF23 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for Cytosolic Sulfotransferase 2B1/SULT2B1 Protein (NBP2-33396PEP) (0)

There are no publications for Cytosolic Sulfotransferase 2B1/SULT2B1 Protein (NBP2-33396PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 2B1/SULT2B1 Protein (NBP2-33396PEP) (0)

There are no reviews for Cytosolic Sulfotransferase 2B1/SULT2B1 Protein (NBP2-33396PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cytosolic Sulfotransferase 2B1/SULT2B1 Protein (NBP2-33396PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytosolic Sulfotransferase 2B1/SULT2B1 Products

Blogs on Cytosolic Sulfotransferase 2B1/SULT2B1

There are no specific blogs for Cytosolic Sulfotransferase 2B1/SULT2B1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cytosolic Sulfotransferase 2B1/SULT2B1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SULT2B1