![Western Blot: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Analysis using Anti-CNDP2 antibody NBP2-38338 (A) shows similar pattern to independent antibody NBP2-38337 (B).](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Western-Blot-NBP2-38338-img0006.jpg "Western Blot: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Analysis using Anti-CNDP2 antibody NBP2-38338 (A) shows similar pattern to independent antibody NBP2-38337 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGS |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CNDP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human cell line RT4 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38338-img0003.jpg "Immunocytochemistry/Immunofluorescence: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human cell line RT4 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining in human kidney and skeletal muscle tissues using NBP2-38338 antibody. Corresponding CNDP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Immunohistochemistry-Paraffin-NBP2-38338-img0011.jpg "Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining in human kidney and skeletal muscle tissues using NBP2-38338 antibody. Corresponding CNDP2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Immunohistochemistry-Paraffin-NBP2-38338-img0007.jpg "Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Immunohistochemistry-Paraffin-NBP2-38338-img0008.jpg "Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Immunohistochemistry-Paraffin-NBP2-38338-img0009.jpg "Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Cytosol-Nonspecific-Dipeptidase-CNDP2-CPGL-Antibody-Immunohistochemistry-Paraffin-NBP2-38338-img0010.jpg "Immunohistochemistry-Paraffin: Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody [NBP2-38338] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.")
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")