![Western Blot: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - analysis of CYP2J2 expression in transfected 293T cell line by CYP2J2 monoclonal antibody (M01), clone 2D10. Lane 1: CYP2J2 transfected lysate (58 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Cytochrome-p450-2J2-Antibody-2D10-Western-Blot-H00001573-M01-img0003.jpg "Western Blot: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - analysis of CYP2J2 expression in transfected 293T cell line by CYP2J2 monoclonal antibody (M01), clone 2D10. Lane 1: CYP2J2 transfected lysate (58 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2D10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CYP2J2 (NP_000766, 408 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA |
| Specificity | CYP2J2 - cytochrome P450, family 2, subfamily J, polypeptide 2 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CYP2J2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome p450 2J2 Antibody (H00001573-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - CYP2J2 monoclonal antibody (M01), clone 2D10 Western Blot analysis of CYP2J2 expression in HepG2 ( Cat # L019V1 ).](http://images.novusbio.com/fullsize/Cytochrome-p450-2J2-Antibody-2D10-Western-Blot-H00001573-M01-img0002.jpg "Western Blot: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - CYP2J2 monoclonal antibody (M01), clone 2D10 Western Blot analysis of CYP2J2 expression in HepG2 ( Cat # L019V1 ).")
![ELISA: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - Detection limit for recombinant GST tagged CYP2J2 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Cytochrome-p450-2J2-Antibody-2D10-ELISA-H00001573-M01-img0006.jpg "ELISA: Cytochrome p450 2J2 Antibody (2D10) [H00001573-M01] - Detection limit for recombinant GST tagged CYP2J2 is approximately 3ng/ml as a capture antibody.")
![HAI-2/SPINT2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "HAI-2/SPINT2 Antibody [Unconjugated]")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")