CSAD Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CSAD |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CSAD Antibody
Background
CSAD, also known as Cysteine sulfinic acid decarboxylase-related protein, consists of a 582 amino acid isoform that is 64 kDa, and is involved in the process through which cysteinesulfinate undergoes decarboxylation to produce hypotaurine. Current research is being conducted on CSAD to determine its relation to several diseases and disorders, including pulmonary edema, stiff-person syndrome, hepatocellular carcinoma, prostate cancer, seizures, and autoimmune diseases. CSAD interacts with SMN1, SMN2, ANXA1, ANXA7, and CDKN1A in several metabolic pathways and taurine biosynthesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, Simple Western
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Publications for CSAD Antibody (NBP1-84373) (0)
There are no publications for CSAD Antibody (NBP1-84373).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CSAD Antibody (NBP1-84373) (0)
There are no reviews for CSAD Antibody (NBP1-84373).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CSAD Antibody (NBP1-84373) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CSAD Products
Blogs on CSAD