Novus Biologicals products are now on bio-techne.com

CROT Recombinant Protein Antigen

Name: CROT Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85503PEP
Price: 279 USD

Images

There are currently no images for CROT Protein (NBP1-85503PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CROT Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CROT. Source: E. coli Amino Acid Sequence: LAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWH Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CROT
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85503. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CROT Recombinant Protein Antigen

carnitine O-octanoyltransferase
COTperoxisomal carnitine O-octanoyltransferase
EC 2.3.1
EC 2.3.1.137
peroxisomal carnitine acyltransferase
peroxisomal carnitine octanoyltransferase

Background

Carnitine octanoyltransferase (EC 2.3.1.137) is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria. See also CRAT (MIM 600184). Van der Leij et al. (2000) [PubMed 11001805] reviewed the function, structural features, and phylogenetics of human carnitine acyltransferase genes, including CROT.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CRAT Antibody

NBP1-86616

Immunohistochemistry-Paraffin CRAT Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

Cytochrome P450
2A6 Antibody (OTI1D2)

NBP2-01437

Immunohistochemistry-Paraffin Cytochrome P450 2A6 Antibody (OTI1D2)

Species: Hu, Pm, Mu, Pm, Rt

Applications: Flow, IHC, IHC-P, WB

MAP3K8/Tpl2/COT
Antibody

NBP1-62178

(4 Publications)

Species: Hu, Mu, Rt

Applications: ELISA

CHPT1 Antibody -
Azide and BSA Free

NBP2-92299

(1 Review)

Species: Hu

Applications: WB

Dehydrodolichyl
Diphosphate Synthase ...

NBP1-87964

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

CPT1A Antibody

NB100-53791

Immunohistochemistry-Paraffin CPT1A Antibody

(9 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, PEP-ELISA, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

EphB2 Antibody
[Unconjugated]

AF467

Western Blot EphB2 Antibody [Unconjugated]

Immunocytochemistry EphB2 Antibody [Unconjugated]

(5 Reviews)

(62 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

MDR3/ABCB4 Antibody

NBP2-30876

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

JNK1 Antibody
(228601) [Unconjugate

MAB17761

Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Protein Kinase A
regulatory subunit I ...

NBP1-47935

Western Blot Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

CAR/NR1I3 Antibody
(N4111) [Unconjugated ...

PP-N4111-00

(8 Publications)

Species: Hu

Applications: IHC, IP, WB

Arrestin 3 Antibody

NBP1-37003

(9 Publications)

Species: Hu, Pm

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

CXADR Antibody
[Unconjugated]

AF2654

Simple Western CXADR Antibody [Unconjugated]

(6 Publications)

Species: Mu

Applications: IHC, Simple Western, WB

TRIM13 Antibody

NBP1-85016

Immunohistochemistry-Paraffin TRIM13 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

GLYAT Antibody

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Publications for CROT Protein (NBP1-85503PEP) (0)

There are no publications for CROT Protein (NBP1-85503PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CROT Protein (NBP1-85503PEP) (0)

There are no reviews for CROT Protein (NBP1-85503PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CROT Protein (NBP1-85503PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CROT Products

Blogs on CROT

There are no specific blogs for CROT, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our CROT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CROT

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

CROT Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

CROT Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CROT Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CROT Protein (NBP1-85503PEP) (0)

Reviews for CROT Protein (NBP1-85503PEP) (0)

FAQs for CROT Protein (NBP1-85503PEP) (0)

Additional CROT Products

Blogs on CROT

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics