![Western Blot: CRB3 Antibody [H00092359-B01P] - Analysis of CRB3 expression in transfected 293T cell line by CRB3 polyclonal antibody. Lane 1: CRB3 transfected lysate(13.2 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CRB3-Antibody-Western-Blot-H00092359-B01P-img0005.jpg "Western Blot: CRB3 Antibody [H00092359-B01P] - Analysis of CRB3 expression in transfected 293T cell line by CRB3 polyclonal antibody. Lane 1: CRB3 transfected lysate(13.2 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | CRB3 (NP_631900.1, 1 a.a. - 120 a.a.) full-length human protein. MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI |
| Specificity | CRB3 - crumbs homolog 3 (Drosophila), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CRB3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRB3 |
| Entrez |
|
| Uniprot |
|
![Western Blot: CRB3 Antibody [H00092359-B01P] - CRB3 MaxPab polyclonal antibody. Western Blot analysis of CRB3 expression in A-549.](http://images.novusbio.com/fullsize/CRB3-Antibody-Western-Blot-H00092359-B01P-img0001.jpg "Western Blot: CRB3 Antibody [H00092359-B01P] - CRB3 MaxPab polyclonal antibody. Western Blot analysis of CRB3 expression in A-549.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")