Home » CPEB1 » CPEB1 Proteins » CPEB1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CPEB1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CPEB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPEB1.

Source: E. coli

Amino Acid Sequence: WDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CPEB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56162.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CPEB1 Recombinant Protein Antigen

  • CPEBCEBP
  • CPE-binding protein 1
  • CPE-BP1
  • cytoplasmic polyadenylation element binding protein 1
  • cytoplasmic polyadenylation element-binding protein 1
  • FLJ13203
  • h-CEBP
  • hCPEB-1
  • MGC34136
  • MGC60106

Background

CPEB1 encodes a member of the cytoplasmic polyadenylation element (CPE) binding protein family. This highly conserved protein binds to a specific RNA sequence called the CPE found in the 3' UTR of some mRNAs. Similar proteins in Xenopus and mouse function to induce cytoplasmic polyadenylation of dormant mRNAs with short polyA tails, resulting in their translation. Members of this protein family regulate translation of cyclin B1 during embryonic cell divisions. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carboxypeptidase
E/CPE Antibody
NBP2-15699
Immunohistochemistry-Frozen Carboxypeptidase E/CPE Antibody
Western Blot Carboxypeptidase E/CPE Antibody
Western Blot Carboxypeptidase E/CPE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Immunohistochemistry Cyclin B1 Antibody [Unconjugated]
Western Blot Cyclin B1 Antibody [Unconjugated]
Simple Western Cyclin B1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
MOS Antibody
NBP1-86241
Western Blot MOS Antibody
Immunohistochemistry-Paraffin MOS Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MOCOS Antibody
NBP2-14243
Western Blot MOCOS Antibody
Simple Western MOCOS Antibody
Simple Western MOCOS Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
PARN Antibody
(OTI4D12)
NBP2-46321
Immunohistochemistry PARN Antibody (OTI4D12)
Immunohistochemistry PARN Antibody (OTI4D12)
Immunohistochemistry PARN Antibody (OTI4D12)
Species: Hu, Mu, Rt
Applications: IHC, WB
PAPD1 Antibody
(1D3)
NBP2-43686
Western Blot PAPD1 Antibody (1D3)
Immunocytochemistry/ Immunofluorescence PAPD1 Antibody (1D3)
Immunohistochemistry-Paraffin PAPD1 Antibody (1D3)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PAPD4 Antibody
NBP3-18647
ELISA PAPD4 Antibody
Western Blot PAPD4 Antibody
Species: Hu
Applications: ELISA, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CPEB3 Antibody -
Azide and BSA Free
NBP2-92754
Western Blot CPEB3 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin CPEB3 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin CPEB3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DDX6 Antibody
NB200-191
Immunoprecipitation DDX6 Antibody
Immunohistochemistry-Paraffin DDX6 Antibody
Immunocytochemistry/ Immunofluorescence DDX6 Antibody
(1 Review)
(43 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DAZL Antibody
NB100-2437
Western Blot DAZL Antibody
(15 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
CPEB4 Antibody
NBP1-80468
Western Blot CPEB4 Antibody
Western Blot CPEB4 Antibody
Western Blot CPEB4 Antibody
Species: Hu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
Aurora A Antibody
- BSA Free
NBP1-51843
Western Blot Aurora A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aurora A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aurora A Antibody - BSA Free
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP) (0)

There are no publications for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP) (0)

There are no reviews for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPEB1 Products

Research Areas for CPEB1 Recombinant Protein Antigen (NBP2-56162PEP)

Find related products by research area.

Blogs on CPEB1

There are no specific blogs for CPEB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Immunoprecipitation: DDX6 Antibody [NB200-191] - Detection of human DDX6 by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX6 antibody NB200-191 used at 0.04 ug/ml for WB (A and B) and at 3 ug/mg lysate for IP. DDX6 was also immunoprecipitated using rabbit anti-DDX6 antibody NB200-192, but not with 'DDX6 Ab', which is to another epitope from DDX6. Normal rabbit IgG was used as a negative control. Detection: Chemiluminescence with an exposure time of 1 second (A & B).
DDX6 Antibody
NB200-191

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CPEB1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CPEB1