![Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/COX11-Antibody-Western-Blot-H00001353-B02P-img0001.jpg "Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | COX11 (AAH05895, 1 a.a. - 276 a.a.) full-length human protein. MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRWQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | COX11 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for WB. ICC/IF usage reported in scientific literature (PMID: 25725288). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00001353-B02P | Applications | Species |
|---|---|---|
| Melo Hanchuk TD, Papa PF, La Guardia PG et al. Nek5 interacts with mitochondrial proteins and interferes negatively in mitochondrial mediated cell death and respiration Cell. Signal. 2015-06-01 [PMID: 25725288] (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for COX11 Antibody (H00001353-B02P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")