Home » Connexin 43/GJA1 » Connexin 43/GJA1 Proteins » Connexin 43/GJA1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Connexin 43/GJA1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Connexin 43/GJA1 Protein (NBP2-38234PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Connexin 43/GJA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GJA1.

Source: E. coli

Amino Acid Sequence: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GJA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38234.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Connexin 43/GJA1 Recombinant Protein Antigen

  • Connexin 43
  • connexin-43
  • CX43
  • CX43gap junction protein, alpha-like
  • DFNB38
  • Gap junction 43 kDa heart protein
  • gap junction alpha-1 protein
  • gap junction protein, alpha 1, 43kDa (connexin 43)
  • gap junction protein, alpha 1, 43kDa
  • GJA1
  • GJAL
  • HSS
  • ODD
  • ODDD
  • ODOD
  • SDTY3

Background

Connexin 43/GJA1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. GJA1 is the major cardiac gap junction protein, which is thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. GJA1 is targeted by several protein kinases that regulate myocardial cell cell coupling. A related intronless GJA1 pseudogene, GJA1P, has been mapped to chromosome 5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Connexin 32/GJB1
Antibody (M12.13)
NBP2-53381
Western Blot Connexin 32/GJB1 Antibody (M12.13)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Connexin 26/GJB2
Antibody - BSA Free
NBP2-41304
Western Blot Connexin 26/GJB2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Connexin 26/GJB2 Antibody - BSA Free
Immunohistochemistry Connexin 26/GJB2 Antibody - BSA Free
(5 Publications)
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Connexin 30/GJB6
Antibody (CL4540)
NBP2-61141
Immunocytochemistry/ Immunofluorescence Connexin 30/GJB6 Antibody (CL4540)
Immunocytochemistry/ Immunofluorescence Connexin 30/GJB6 Antibody (CL4540)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Connexin 36/GJD2
Antibody
NBP1-59254
Immunohistochemistry Connexin 36/GJD2 Antibody
Western Blot Connexin 36/GJD2 Antibody
Western Blot Connexin 36/GJD2 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
N-Cadherin
Antibody (13A9)
NBP1-48309
Flow (Intracellular) N-Cadherin Antibody (13A9)
Flow Cytometry N-Cadherin Antibody (13A9)
Immunocytochemistry/ Immunofluorescence N-Cadherin Antibody (13A9)
(2 Reviews)
(41 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(547 Publications)
Species: Hu
Applications: BA
Connexin 46/GJA3
Antibody
NBP2-58660
Immunohistochemistry-Paraffin Connexin 46/GJA3 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for Connexin 43/GJA1 Protein (NBP2-38234PEP) (0)

There are no publications for Connexin 43/GJA1 Protein (NBP2-38234PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 43/GJA1 Protein (NBP2-38234PEP) (0)

There are no reviews for Connexin 43/GJA1 Protein (NBP2-38234PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Connexin 43/GJA1 Protein (NBP2-38234PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 43/GJA1 Products

Research Areas for Connexin 43/GJA1 Protein (NBP2-38234PEP)

Find related products by research area.

Blogs on Connexin 43/GJA1.

Check out the latest blog posts on Connexin 43/GJA1.
Connexin: Bridging the Gap of Intercellular Communication
Connexin 43/GJA1 is a member of the connexin gene family and the most abundant protein component found within gap junctions. Gap junctions are the cell-to-cell contacts that provide direct intercellular communication between cells by regulating back a...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Connexin 43/GJA1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GJA1