Home » Complement Factor H-related 1/CFHR1/CFHL1 » Complement Factor H-related 1/CFHR1/CFHL1 Proteins » Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CFHR1.

Source: E. coli

Amino Acid Sequence: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CFHR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14474.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen

  • BTA
  • CFHL1FHR-1
  • CFHLCFHR1P
  • CFHR1
  • complement factor H-related 1 pseudogene
  • Complement Factor Hrelated 1
  • Complement Factor H-related 1
  • complement factor H-related protein 1
  • FHR1
  • FHR1CFHL1P
  • H factor (complement)-like 1
  • H factor (complement)-like 2
  • H factor-like protein 1
  • H36-1
  • H36-2
  • H-factor-like 1
  • HFL1H36
  • HFL2
  • MGC104329

Background

The CFHL1 gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonasaeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed thatTuf acts as a virulence fac

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
FHL1 Antibody
(767418)
MAB5938
Western Blot FHL1 Antibody (767418)
Immunocytochemistry FHL1 Antibody (767418)
(3 Publications)
Species: Hu
Applications: ICC, WB
Complement Factor
H-related 3/CFHR3 Ant ...
NBP2-92515
Western Blot Complement Factor H-related 3/CFHR3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Fumarase Antibody
NBP1-31336
Western Blot Fumarase Antibody
Western Blot Fumarase Antibody
Immunocytochemistry/ Immunofluorescence Fumarase Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
LDLR Antibody
[Unconjugated]
AF2255
Immunohistochemistry LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
(47 Publications)
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Complement Factor
B Antibody
NBP1-89985
Immunocytochemistry/ Immunofluorescence Complement Factor B Antibody
Immunohistochemistry-Paraffin Complement Factor B Antibody
Immunohistochemistry-Paraffin Complement Factor B Antibody
(7 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD46 Antibody
(344519) [Unconjugate
MAB2005
N/A CD46 Antibody (344519) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Complement Factor
H-related 5/CFHR5 Ant ...
NBP2-52441
Western Blot Complement Factor H-related 5/CFHR5 Antibody (3A10A5) - BSA Free
Western Blot Complement Factor H-related 5/CFHR5 Antibody (3A10A5) - BSA Free
ELISA Complement Factor H-related 5/CFHR5 Antibody (3A10A5) - BSA Free
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Complement Factor
I Antibody (271203)
MAB3307
Complement Factor I Antibody (271203)
(3 Publications)
Species: Hu
Applications: IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Complement Factor
H-related 4/CFHR4 Ant ...
MAB5980
Western Blot Complement Factor H-related 4/CFHR4 Antibody (640212) [Unconjugated]
Intracellular Staining by Flow Cytometry Complement Factor H-related 4/CFHR4 Antibody (640212) [Unconjugated]
Immunocytochemistry Complement Factor H-related 4/CFHR4 Antibody (640212) [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Complement
Component C5a [Biotin
DY2037
N/A Complement Component C5a [Biotin]
(27 Publications)
Species: Hu
Applications: ELISA
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
Complement Factor
H-related 2/CFHR2/CFH ...
MAB5484
Complement Factor H-related 2/CFHR2/CFHL2 Antibody (510511)
(3 Publications)
Species: Hu
Applications: IP, WB
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB
C4 binding protein
A Antibody
NBP1-88262
Western Blot C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Species: Hu
Applications: IHC, IHC-P, WB
AMD1 Antibody
NBP1-87094
Immunocytochemistry/ Immunofluorescence AMD1 Antibody
Immunohistochemistry-Paraffin AMD1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
Complement Factor
H-related 1/CFHR1/CFH ...
NBP2-14474PEP
Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP) (0)

There are no publications for Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP) (0)

There are no reviews for Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Complement Factor H-related 1/CFHR1/CFHL1 Protein (NBP2-14474PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement Factor H-related 1/CFHR1/CFHL1 Products

Blogs on Complement Factor H-related 1/CFHR1/CFHL1

There are no specific blogs for Complement Factor H-related 1/CFHR1/CFHL1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CFHR1