I am looking for a recombinant mouse C5 as standard for a mouse C5 ELISA. Is your product # H00000727-Q01 good for this?

Name: Recombinant Human Complement C5 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000727-Q01
Price: 569 USD

Question

Accepted Answer

This product is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. H00000727-Q01 is a partial recombinant protein, so you will want to make sure your antibody will recognize the portion of C5 present in this protein before using it as a control.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Description	A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-112 of Human C5 Source: Wheat Germ (in vitro) Amino Acid Sequence: QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	C5
Purity	>80% by SDS-PAGE and Coomassie blue staining

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Recombinant Human Complement C5 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Complement C5 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Complement C5 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Complement C5 Partial Recombinant Protein (H00000727-Q01) (0)

Reviews for Complement C5 Partial Recombinant Protein (H00000727-Q01) (0)

Product General Protocols

Video Protocols

FAQs for Complement C5 Partial Recombinant Protein (H00000727-Q01). (Showing 1 - 1 of 1 FAQ).

Additional Complement C5 Products

Research Areas for Complement C5 Partial Recombinant Protein (H00000727-Q01)

Blogs on Complement C5.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics