Collectrin/TMEM27 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: LVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CLTRN |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Collectrin/TMEM27 Antibody
Background
The Tmem27 gene encodes a transmembrane protein that is important for trafficking amino acid transporters to the apical brushborder of proximal tubules. It also plays a role in controlling insulin exocytosis by regulating formation of theSNARE (soluble N-ethylm
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, ELISA(Cap), S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Publications for Collectrin/TMEM27 Antibody (NBP2-13450) (0)
There are no publications for Collectrin/TMEM27 Antibody (NBP2-13450).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Collectrin/TMEM27 Antibody (NBP2-13450) (0)
There are no reviews for Collectrin/TMEM27 Antibody (NBP2-13450).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Collectrin/TMEM27 Antibody (NBP2-13450) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Collectrin/TMEM27 Products
Research Areas for Collectrin/TMEM27 Antibody (NBP2-13450)
Find related products by research area.
|
Blogs on Collectrin/TMEM27