Western Blot: CNOT2 Antibody [NBP2-56034] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: CNOT2 Antibody [NBP2-56034] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNOT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for CNOT2 Antibody - BSA Free
CCR4-associated factor 2
CCR4-NOT transcription complex, subunit 2
CDC36FLJ26456
negative regulator of transcription 2
NOT2CCR4-NOT transcription complex subunit 2
NOT2H
Background
The CCR4-NOT complex functions as general transcription regulation complex
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CNOT2 Antibody - BSA Free and receive a gift card or discount.
![Western Blot: CNOT2 Antibody [NBP2-56034] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/CNOT2-Antibody-Western-Blot-NBP2-56034-img0006.jpg "Western Blot: CNOT2 Antibody [NBP2-56034] - Analysis in human cell line RT-4.")
![Immunocytochemistry/Immunofluorescence: CNOT2 Antibody [NBP2-56034] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CNOT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56034-img0001.jpg "Immunocytochemistry/Immunofluorescence: CNOT2 Antibody [NBP2-56034] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/CNOT2-Antibody-Immunohistochemistry-Paraffin-NBP2-56034-img0005.jpg "Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/CNOT2-Antibody-Immunohistochemistry-Paraffin-NBP2-56034-img0002.jpg "Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CNOT2-Antibody-Immunohistochemistry-Paraffin-NBP2-56034-img0003.jpg "Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CNOT2-Antibody-Immunohistochemistry-Paraffin-NBP2-56034-img0004.jpg "Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.")
![Flow Cytometry CCR4 Antibody (205410) [Unconjugated]](https://images.novusbio.com/images2/CCR4_MAB1567_Flow_Cytometry_20627.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")