Home » CLIC3 » CLIC3 Proteins » CLIC3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CLIC3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLIC3 Protein (NBP1-89465PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CLIC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLIC3.

Source: E. coli

Amino Acid Sequence: MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLIC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89465.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLIC3 Recombinant Protein Antigen

  • chloride intracellular channel 3
  • chloride intracellular channel protein 3

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Connexin 26/GJB2
Antibody - BSA Free
NBP2-41304
Western Blot Connexin 26/GJB2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Connexin 26/GJB2 Antibody - BSA Free
Immunohistochemistry Connexin 26/GJB2 Antibody - BSA Free
(5 Publications)
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CLIC1 Antibody -
BSA Free
NBP2-92860
Western Blot CLIC1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CLIC1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CLIC1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
CLIC5 Antibody
(1E6)
H00053405-M03
Immunohistochemistry-Paraffin CLIC5 Antibody (1E6)
Immunocytochemistry/ Immunofluorescence CLIC5 Antibody (1E6)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
CLIC4 Antibody
NBP1-85574
Immunohistochemistry-Paraffin CLIC4 Antibody
Immunohistochemistry-Paraffin CLIC4 Antibody
Western Blot CLIC4 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AP3B1 Antibody
NBP3-38363
Western Blot AP3B1 Antibody
Immunohistochemistry AP3B1 Antibody
Immunohistochemistry AP3B1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NEU3 Antibody -
Azide and BSA Free
NBP3-04868
Western Blot NEU3 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NEU3 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Rab25 Antibody
(3F12) - BSA Free
NBP1-51599
Flow Cytometry Rab25 Antibody (3F12) - BSA Free
Immunohistochemistry-Paraffin Rab25 Antibody (3F12) - BSA Free
Western Blot Rab25 Antibody (3F12) - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
gp96/HSP90B1/GRP94
Antibody (9G10)
NB300-619
Immunocytochemistry/ Immunofluorescence gp96/HSP90B1/GRP94 Antibody (9G10)
Immunocytochemistry/ Immunofluorescence gp96/HSP90B1/GRP94 Antibody (9G10)
Immunocytochemistry/ Immunofluorescence gp96/HSP90B1/GRP94 Antibody (9G10)
(2 Reviews)
(5 Publications)
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
CLIC2 Antibody
NBP2-32516
Western Blot CLIC2 Antibody
Immunohistochemistry-Paraffin CLIC2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
P2X2/P2RX2 Antibody
NBP2-19655
Immunohistochemistry-Paraffin P2X2/P2RX2 Antibody
Western Blot P2X2/P2RX2 Antibody
Immunocytochemistry/ Immunofluorescence P2X2/P2RX2 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DDO Antibody
NBP1-85884
Immunocytochemistry/ Immunofluorescence DDO Antibody
Immunohistochemistry-Paraffin DDO Antibody
Immunohistochemistry-Paraffin DDO Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
RAB33A Antibody
(8A11)
H00009363-M04
Western Blot RAB33A Antibody (8A11)
Sandwich ELISA RAB33A Antibody (8A11)
Species: Hu
Applications: ELISA, S-ELISA, WB
SOX5 Antibody
AF5286
Western Blot SOX5 Antibody
(1 Publication)
Species: Hu
Applications: WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(431 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Bcl G Antibody
(6R9F3)
NBP3-15746
Immunohistochemistry-Paraffin Bcl G Antibody (6R9F3)
Immunohistochemistry-Paraffin Bcl G Antibody (6R9F3)
Immunohistochemistry-Paraffin Bcl G Antibody (6R9F3)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for CLIC3 Protein (NBP1-89465PEP) (0)

There are no publications for CLIC3 Protein (NBP1-89465PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC3 Protein (NBP1-89465PEP) (0)

There are no reviews for CLIC3 Protein (NBP1-89465PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLIC3 Protein (NBP1-89465PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLIC3 Products

Array NBP1-89465PEP

Blogs on CLIC3

There are no specific blogs for CLIC3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221
10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLIC3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLIC3