![Western Blot: CIAO1 Antibody [NBP2-84682] - Host: Rabbit. Target Name: CIAO1. Sample Type: MCF7. Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in MCF7](http://images.novusbio.com/fullsize/CIAO1-Antibody-Western-Blot-NBP2-84682-img0003.jpg "Western Blot: CIAO1 Antibody [NBP2-84682] - Host: Rabbit. Target Name: CIAO1. Sample Type: MCF7. Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in MCF7")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CIAO1. Peptide sequence: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CIAO1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CIAO1 Antibody (NBP2-84682)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CIAO1 |
![Immunohistochemistry-Paraffin: CIAO1 Antibody [NBP2-84682] - Rabbit Anti-CIAO1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue. Observed Staining: Cytoplasmic in alveolar type I cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1/600. Secondary Antibody: Donkey anti-Ra](http://images.novusbio.com/fullsize/CIAO1-Antibody-Immunohistochemistry-Paraffin-NBP2-84682-img0001.jpg "Immunohistochemistry-Paraffin: CIAO1 Antibody [NBP2-84682] - Rabbit Anti-CIAO1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue. Observed Staining: Cytoplasmic in alveolar type I cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1/600. Secondary Antibody: Donkey anti-Ra")
![Western Blot: CIAO1 Antibody [NBP2-84682] - WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B](http://images.novusbio.com/fullsize/CIAO1-Antibody-Western-Blot-NBP2-84682-img0002.jpg "Western Blot: CIAO1 Antibody [NBP2-84682] - WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B")
![Western Blot: CIAO1 Antibody [NBP2-84682] - Host: Rabbit. Target Name: CIAO1. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B](http://images.novusbio.com/fullsize/CIAO1-Antibody-Western-Blot-NBP2-84682-img0004.jpg "Western Blot: CIAO1 Antibody [NBP2-84682] - Host: Rabbit. Target Name: CIAO1. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")