Home » CDC25C » CDC25C Peptides and Proteins » CDC25C Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CDC25C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CDC25C Recombinant Protein Antigen (NBP2-57705PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CDC25C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC25C.

Source: E. coli

Amino Acid Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC25C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57705.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC25C Recombinant Protein Antigen

  • CDC 25
  • CDC25
  • CDC25C
  • cell division cycle 25 homolog C (S. cerevisiae)
  • cell division cycle 25 homolog C (S. pombe)
  • cell division cycle 25C
  • Dual specificity phosphatase Cdc25C
  • EC 3.1.3.48
  • mitosis inducer CDC25
  • M-phase inducer phosphatase 3
  • phosphotyrosine phosphatase

Background

Cdc25C is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Immunohistochemistry Cyclin B1 Antibody [Unconjugated]
Western Blot Cyclin B1 Antibody [Unconjugated]
Simple Western Cyclin B1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western Blot Chk2 [p Thr68] Antibody [Unconjugated]
Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
CDC25A Antibody
(336445)
MAB1648
Western Blot CDC25A Antibody (336445)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
CDC25B Antibody
[Unconjugated]
AF1649
Western Blot CDC25B Antibody [Unconjugated]
Immunocytochemistry CDC25B Antibody [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Wee1 Antibody
NBP1-33506
Western Blot Wee1 Antibody
Immunohistochemistry-Paraffin Wee1 Antibody
Western Blot Wee1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
CDK2 Antibody
(OTI2D9)
NBP2-00776
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(46 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
CDC25C Recombinant
Protein Antigen
NBP2-57705PEP
CDC25C Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CDC25C Recombinant Protein Antigen (NBP2-57705PEP) (0)

There are no publications for CDC25C Recombinant Protein Antigen (NBP2-57705PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC25C Recombinant Protein Antigen (NBP2-57705PEP) (0)

There are no reviews for CDC25C Recombinant Protein Antigen (NBP2-57705PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC25C Recombinant Protein Antigen (NBP2-57705PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC25C Products

Research Areas for CDC25C Recombinant Protein Antigen (NBP2-57705PEP)

Find related products by research area.

Blogs on CDC25C

There are no specific blogs for CDC25C, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockdown Validated: ATM Antibody (2C1) [NB100-309] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (60 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:500.
ATM Antibody (2C1)
NB100-309
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
PCNA Antibody (PC10)
NB500-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC25C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDC25C