Home » CD72 » CD72 Proteins » CD72 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD72 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD72 Protein (NBP2-38533PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD72 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD72.

Source: E. coli

Amino Acid Sequence: AQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD72
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38533.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD72 Recombinant Protein Antigen

  • CD72 antigenB-cell differentiation antigen CD72
  • CD72 molecule
  • CD72
  • CD72b
  • Ly-19.2
  • Ly-32.2
  • Lyb-2
  • LYB2lyb-2

Background

CD72 antigen is a member of the type II integral membrane glycoproteins which includes other related cell surface molecules such as the asialoglycoprotein receptors, CD23 and the Kupffer cell receptor. The function of CD72 is unknown but the exposure of B cells to CD72 antibodies activates a variety of signaling pathways and can induce MHC class II expression and B cell proliferation. CD72 antigen is expressed on all cells of B cell lineage with the exception of plasma cells and weakly on human tissue macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD5 Antibody
(OTI7A7) - Azide and ...
NBP2-70360
Western Blot CD5 Antibody (OTI7A7) - Azide and BSA Free
Flow Cytometry CD5 Antibody (OTI7A7) - Azide and BSA Free
Flow Cytometry CD5 Antibody (OTI7A7) - Azide and BSA Free
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
Semaphorin
4D/CD100 Antibody [Un ...
AF5235
Flow Cytometry Semaphorin 4D/CD100 Antibody [Unconjugated]
Immunohistochemistry Semaphorin 4D/CD100 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Siglec-2/CD22
Antibody (OTI1F12)
NBP2-46125
Immunocytochemistry/ Immunofluorescence Siglec-2/CD22 Antibody (OTI1F12)
Immunocytochemistry/ Immunofluorescence Siglec-2/CD22 Antibody (OTI1F12)
Immunocytochemistry/ Immunofluorescence Siglec-2/CD22 Antibody (OTI1F12)
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
SHP-1 Antibody
(SR41-02)
NBP2-67321
Western Blot SHP-1 Antibody (SR41-02)
Flow Cytometry SHP-1 Antibody (SR41-02)
Immunocytochemistry/ Immunofluorescence SHP-1 Antibody (SR41-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
CD23/Fc epsilon
RII Antibody [Unconju ...
AF123
Immunocytochemistry CD23/Fc epsilon RII Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: Block, ICC, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]
Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]
Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]
(25 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(44 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(68 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
CD21 Antibody
(SC0681)
NBP2-67605
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunohistochemistry-Paraffin CD21 Antibody (SC0681)
(1 Publication)
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB

Publications for CD72 Protein (NBP2-38533PEP) (0)

There are no publications for CD72 Protein (NBP2-38533PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD72 Protein (NBP2-38533PEP) (0)

There are no reviews for CD72 Protein (NBP2-38533PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD72 Protein (NBP2-38533PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD72 Products

Research Areas for CD72 Protein (NBP2-38533PEP)

Find related products by research area.

Blogs on CD72

There are no specific blogs for CD72, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010
CD45 was detected in immersion fixed paraffin-embedded sections of mouse liver using Goat Anti-Mouse CD45 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF114) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to Kupffer cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
CD45 Antibody [Unconjugated]
AF114

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD72 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD72