Novus Biologicals products are now on bio-techne.com

CBX4 Recombinant Protein Antigen

Images

 
There are currently no images for CBX4 Protein (NBP1-83225PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CBX4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBX4.

Source: E. coli

Amino Acid Sequence: QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CBX4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83225.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CBX4 Recombinant Protein Antigen

  • chromobox homolog 4 (Drosophila Pc class)
  • chromobox homolog 4
  • Chromobox protein homolog 4
  • Drosophila)
  • E3 SUMO-protein ligase CBX4
  • hPC2
  • NS5ATP1-binding protein 16
  • Pc class 2 homolog
  • PC2
  • Polycomb 2 homolog

Background

PC2 is the human homolog of the Drosophila 'Polycomb' (Pc) protein which has been identified as a gene family member associated with a cellular memory system that is responsible for the inheritance of gene activity by progeny cells. The human Pc homolog gene is more closely related to a Xenopus Pc homolog, XPc, than to a previously described human Pc homolog, CBX2 (hPc1). However, the hPc2 and CBX2/hPc1 proteins are shown to colocalize in interphase nuclei of human U-2 OS osteosarcoma cells, suggesting that the proteins are part of a common protein complex. The human protein is believed to function as a repressor of proto-oncogene activity and that interference with hPc2 function can lead to derepression of proto-oncogene transcription and subsequently to cellular transformation. Other reports describe PC2 as a protein that has SUMO E3 activity for the corepressors CtBP and CtBP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
1503-SE
Species: Hu
Applications: EnzAct
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15275
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24679
Species: Bv, Ca, Hu, Po, Pm
Applications: IHC, IHC-P, WB
NBP1-87354
Species: Hu
Applications: IHC, IHC-P
AF3587
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
NBP2-73621
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
AF6270
Species: Hu
Applications: ICC

Publications for CBX4 Protein (NBP1-83225PEP) (0)

There are no publications for CBX4 Protein (NBP1-83225PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBX4 Protein (NBP1-83225PEP) (0)

There are no reviews for CBX4 Protein (NBP1-83225PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CBX4 Protein (NBP1-83225PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBX4 Products

Array NBP1-83225PEP

Research Areas for CBX4 Protein (NBP1-83225PEP)

Find related products by research area.

Blogs on CBX4

There are no specific blogs for CBX4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CBX4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX4