CBFB Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV |
Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CBFB |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CBFB Antibody
Background
The transcription factor Polyomavirus enhancer binding protein 2 (PEBP2), also designated Osf2 (Osteoblast-specific transcription factor), CBFA1 (Core Binding Factor) and AML3 (Acute myeloid leukemia), is composed of two subunits, alpha and beta, which are essential for the regulation of hematopoiesis and osteogenesis. The PEBP2alpha subunits, PEBP2alphaA, PEBP2alphaB and PEBP2alphaC, are encoded by three RUNX genes, all of which contain a 128-amino acid region homologous to the highly conserved Drosophila segmentation gene, runt. This region is involved in DNA binding and heterodimerization with the regulatory beta subunit, which facilitates DNA binding of the alpha subunit. Both subunits are required for in vivo function; the disruption of either gene results in a lack of definitive hematopoiesis followed by embryo death in utero due to hemorrhage in the central nervous system. The gene encoding PEBP2beta is the target of chromosomal inversion 16 (p13;q22) with the smooth muscle myosin heavy chain, producing a chimeric gene, PEBP2beta/CBFbeta-SMMHC, that is associated with human acute myeloid leukemia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu
Applications: WB
Publications for CBFB Antibody (NBP1-87300) (0)
There are no publications for CBFB Antibody (NBP1-87300).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CBFB Antibody (NBP1-87300) (0)
There are no reviews for CBFB Antibody (NBP1-87300).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CBFB Antibody (NBP1-87300) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CBFB Products
Research Areas for CBFB Antibody (NBP1-87300)
Find related products by research area.
|
Blogs on CBFB